DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and alkbh8

DIOPT Version :9

Sequence 1:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:XP_009290865.1 Gene:alkbh8 / 556362 ZFINID:ZDB-GENE-100922-251 Length:666 Species:Danio rerio


Alignment Length:281 Identity:58/281 - (20%)
Similarity:92/281 - (32%) Gaps:65/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EQKLEFTNKYKGSCTLLCSYDSQGVVLRVVSDDDRSHVLKEYMIAADTDAAQMGRRSYAVSLDAD 101
            |:|.....:.|.|.|||...|...|          ||..|..:::       .|.....||.::.
Zfish    12 EEKKLLRRQIKASHTLLKHEDITTV----------SHPTKHLVVS-------NGGLGNGVSRESL 59

  Fly   102 NLVLRFASEQDQQLFRKVVENVKHLRPKSVFSQRTEESSASQYFQFYGYLSQQQNMMQDYVRTST 166
            ..||:.....:..|       ....:|.:..|..:.|:..:.|....|...|    .||...|..
Zfish    60 LEVLKEGGTVESLL-------TPPSKPYAFVSYSSIEAGQNAYTLLNGRTLQ----CQDQTMTLY 113

  Fly   167 YQRAILGNAVDFQDKIVLDVGAGSGILSFF------------------AVQAGAAKVYAIEASNM 213
            :...:   .||....:...:..|..:|..|                  |....|.|  |::...:
Zfish   114 FSYVV---KVDCDRSVSCALPPGLSVLEDFVSLEEELQILKAVDWTPHADDVTAQK--ALKHRRV 173

  Fly   214 AQYAQQLVESNNVQHKISVIPGKIEEIELPEKVDVIISEPM--GYMLYNERMLETYLHARKWLKP 276
            ..|..:....||...|...:||     .||.:.|.::...:  |::    .:|...|...::...
Zfish   174 KHYGYEFRYDNNNVDKDKPLPG-----GLPVECDALLQRCLAGGHI----SVLPDQLTVNQYQSG 229

  Fly   277 QGKMYPTHGDLHIAPFSDESL 297
            ||  .|.|.|.| :||.|..|
Zfish   230 QG--IPPHVDTH-SPFEDTIL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_001262445.1 PH-like 24..134 CDD:302622 19/96 (20%)
PRMT5 53..430 CDD:282971 52/265 (20%)
AdoMet_MTases 183..281 CDD:100107 21/117 (18%)
alkbh8XP_009290865.1 RRM_ALKBH8 40..119 CDD:240877 16/99 (16%)
2OG-FeII_Oxy 130..300 CDD:304390 29/132 (22%)
Methyltransf_11 409..498 CDD:285453
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.