DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and PRMT6

DIOPT Version :9

Sequence 1:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_060607.2 Gene:PRMT6 / 55170 HGNCID:18241 Length:375 Species:Homo sapiens


Alignment Length:341 Identity:126/341 - (36%)
Similarity:176/341 - (51%) Gaps:56/341 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 RPKSVFSQRTEESSASQYFQFYGYLSQQQNMMQDYVRTSTYQRAILGNAVDFQDKIVLDVGAGSG 191
            ||:     ||:......|::.|..:|..:.|:.|.|||..|:..||.|....:.|.|||||||:|
Human    35 RPR-----RTKRERDQLYYECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTG 94

  Fly   192 ILSFFAVQAGAAKVYAIEASNMAQYAQQLVESNNVQHKISVIPGKIEEIELPEKVDVIISEPMGY 256
            |||.|..||||.:|||:|||.:.|.|:::|..|.::.::.|:||.:|.:||||:||.|:||.|||
Human    95 ILSIFCAQAGARRVYAVEASAIWQQAREVVRFNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGY 159

  Fly   257 MLYNERMLETYLHAR-KWLKPQGKMYPTHGDLHIAPFSDESLYSEQYNKANFWYQSAFH-GVDLT 319
            .|.:|.||.:.|||| ||||..|.:.|...:|.|||.||:.|..    :..||.|...| |||::
Human   160 GLLHESMLSSVLHARTKWLKEGGLLLPASAELFIAPISDQMLEW----RLGFWSQVKQHYGVDMS 220

  Fly   320 TLHKEGMKEYFRQPIVDTFDIRICMAKSVRHVCDFLNDKEDDLHLISIPLEF-----------HI 373
            .|  ||            |..|..|..| ..|...|:.::    :::.|..|           ..
Human   221 CL--EG------------FATRCLMGHS-EIVVQGLSGED----VLARPQRFAQLELSRAGLEQE 266

  Fly   374 LQTGI-------C------HGLAFWFDVEFSG--SSQNVWLSTSPTAPLTHWYQVRCLLPMPIFI 423
            |:.|:       |      ||.|.||.|.|.|  |.:.:.|||||..|.|||.|....|..|:.:
Human   267 LEAGVGGRFRCSCYGSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLYLNEPVQV 331

  Fly   424 KQGQTLTGRVLLEANR 439
            :|...::|.:.|..:|
Human   332 EQDTDVSGEITLLPSR 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_001262445.1 PH-like 24..134 CDD:302622 2/6 (33%)
PRMT5 53..430 CDD:282971 123/330 (37%)
AdoMet_MTases 183..281 CDD:100107 55/98 (56%)
PRMT6NP_060607.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38 2/7 (29%)
AdoMet_MTases 67..>200 CDD:418430 68/132 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.