DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and CG3337

DIOPT Version :9

Sequence 1:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001303427.1 Gene:CG3337 / 42519 FlyBaseID:FBgn0038871 Length:204 Species:Drosophila melanogaster


Alignment Length:76 Identity:22/76 - (28%)
Similarity:35/76 - (46%) Gaps:11/76 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 YVRTSTYQRAILGNAVDFQDK----IVLDVGAGSGILSFFAVQ-AGAAKVYAIEASNMAQYAQQL 220
            ||..:|.|   :.|.:.|..|    .:||:|:|.|.:...|.| .||.|...:|.:....|..:|
  Fly    57 YVPATTEQ---IQNVLSFLPKNSAGKLLDIGSGDGRIVVAAAQHCGALKADGVELNPWLVYYSRL 118

  Fly   221 VESNNVQHKIS 231
            ..   ::|.:|
  Fly   119 AA---LRHSVS 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_001262445.1 PH-like 24..134 CDD:302622
PRMT5 53..430 CDD:282971 22/76 (29%)
AdoMet_MTases 183..281 CDD:100107 15/50 (30%)
CG3337NP_001303427.1 Methyltransf_18 78..167 CDD:289607 15/52 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.