DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and Art6

DIOPT Version :9

Sequence 1:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster


Alignment Length:343 Identity:118/343 - (34%)
Similarity:185/343 - (53%) Gaps:44/343 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 ESSASQYFQFYGYLSQQQNMMQDYVRTSTYQRAILGNAVDFQDKIVLDVGAGSGILSFFAVQAGA 202
            |...|.|||.|..|....||::|.||...::.||:.:...||||||||||.|:||||.||.:|||
  Fly    13 EGKDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAAEAGA 77

  Fly   203 AKVYAIEASNMAQYAQQLVESNNVQHKISVIPGKIEEIELP---EKVDVIISEPMGYMLYNERML 264
            :||.|:|.:::|..|::::..|..::.:.|:.|.:|::|||   ||||:|:||.||..||.|.|:
  Fly    78 SKVIAVECTDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGIEKVDIIVSEWMGNALYMEAMI 142

  Fly   265 ETYLHAR-KWLKPQGKMYPTHGDLHIAPFSDESLYSEQYNKANFWYQSAFHGVDLTTLHKEGMKE 328
            .:.|.|| |||...|::.|:.|:|.:....|    ..:....|||..  ..|:|:..:.    |.
  Fly   143 NSVLFARDKWLTRGGRILPSTGNLWLMGAYD----PHRRTNLNFWCN--VEGIDMGCVR----KP 197

  Fly   329 YFRQPIVDTFDIRICMAKSVRHVCDFLNDKEDDLHLISI------PLEFH------ILQTGICHG 381
            :.::|:|:...|:           ..|.| |..:|..::      |:||.      :::|||.:.
  Fly   198 FSQEPLVEFVPIQ-----------QLLTD-ECFIHSTNLAVARNQPVEFQSNFQLKVMRTGIINM 250

  Fly   382 LAFWFDVEF-SG-SSQNVWLSTSPTAPLTHWYQVRCLLPMPIFIKQGQTLTGRVLLEANRRQSYD 444
            |..:|||.| || |:::|.|:|||.:|.|||.|....|..|::::....:.|.:.:....:....
  Fly   251 LVLYFDVLFPSGKSNKSVSLTTSPHSPWTHWEQTVLHLDEPLYVRIRDRVRGVLAMTPTGQDGRG 315

  Fly   445 VTIDLHI----EGTLISS 458
            :..||||    |.|.:.|
  Fly   316 MNFDLHISFRGERTRVES 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_001262445.1 PH-like 24..134 CDD:302622
PRMT5 53..430 CDD:282971 110/309 (36%)
AdoMet_MTases 183..281 CDD:100107 48/101 (48%)
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 60/131 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440097
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.