DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and Art9

DIOPT Version :9

Sequence 1:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_650321.1 Gene:Art9 / 41698 FlyBaseID:FBgn0038188 Length:313 Species:Drosophila melanogaster


Alignment Length:313 Identity:75/313 - (23%)
Similarity:134/313 - (42%) Gaps:42/313 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 NMMQDYVRTSTYQRAILGNAVDFQDKIVLDVGAGSGILSFFAVQAGAAKVYAIEASNMAQYAQQL 220
            :|:.|.:.|..|:.........|:||||||||..||:||..:|:|||.||.|:.....|::..:.
  Fly    14 SMLNDVISTRAYEWVFKRYERLFKDKIVLDVGCRSGLLSLMSVEAGAVKVMALGNRESAEFVSKA 78

  Fly   221 VESNNVQHKISVIPGKIEEIELP---EKVDVIISEPMGYMLYNERMLETYLHAR-KWLKPQGKMY 281
            ......:.....|.|.|.||.||   :|||:|:||.:|:.::.:.:.:..:.|| |||...|.:.
  Fly    79 FIGTEKEDIFEFIDGDIHEIVLPCGLKKVDIIVSEWVGHSVFVDSLFKEVIFAREKWLVKGGFII 143

  Fly   282 PTHGDLHIAPFSDESLYSEQYNKANFWYQSAFHGVDLTTLHKEGMKEYF---RQPIVDTF---DI 340
            |....|.:...:|   :..:..:.|...||.:.|..........:.|.:   .|.|.:.:   .|
  Fly   144 PNVAQLFVCGIAD---HPRKTVEVNILPQSDYPGRSYMVREPVSLIEDYVAKEQLITEKYLLKTI 205

  Fly   341 RICMAKSVRHVCDFLNDKEDDLHLISIPLEFHILQTGICHGLAFWFDV-------EFSGSSQNVW 398
            .:|.|    |:    ||:.     ..:|.:...|:......:..:.|:       :|     .:.
  Fly   206 DLCTA----HI----NDES-----FRVPFKLRGLRDSQLGAVVLYSDIGLCRPRGKF-----RLM 252

  Fly   399 LSTSPTAPLTHWYQVRCLLPMPIFIKQGQTLTGRVLL----EANRRQSYDVTI 447
            .||.|..|.|:..|....:..|:.:.:.:.:.|.:.:    :.:|...|..::
  Fly   253 FSTGPKRPRTYVRQTILFMDNPVEVAKCELVIGELGMYYKPDEHREVEYSFSL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_001262445.1 PH-like 24..134 CDD:302622
PRMT5 53..430 CDD:282971 72/290 (25%)
AdoMet_MTases 183..281 CDD:100107 37/101 (37%)
Art9NP_650321.1 AdoMet_MTases 41..143 CDD:100107 37/101 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440095
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.