DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and prmt7

DIOPT Version :9

Sequence 1:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_956797.2 Gene:prmt7 / 393475 ZFINID:ZDB-GENE-040426-1560 Length:683 Species:Danio rerio


Alignment Length:324 Identity:84/324 - (25%)
Similarity:123/324 - (37%) Gaps:44/324 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 EESSASQYFQFYGYLSQQQNMMQDYVRTSTYQRAILGNAVDFQDK----IVLDVGAGSGILSFFA 197
            |||....|.|... .|...:|:.|..|...|...|.......:.:    :|||:|.|:|:||..|
Zfish    19 EESEEYDYHQEIA-RSCYADMLHDKDRNEKYYEGIRAAVRRVKARGERPVVLDIGTGTGLLSMMA 82

  Fly   198 VQAGAAKVYAIEA-SNMAQYAQQLVESNNVQHKISVIPGKIEEI------ELPEKVDVIISEPMG 255
            |.|||...||||. ..|||.|..:||.|....||.:|.....|:      ::.|:.:::::|...
Zfish    83 VTAGADFCYAIEVFKPMAQAASCIVERNGFSDKIKIINKHSTEVTVGPDGDMQERANILVTELFD 147

  Fly   256 YMLYNERMLETYLHARKWLKPQG-KMYPTHGDLHIAPFSDESLYSEQYNKANFWYQSAFHGVDLT 319
            ..|..|..|.:|.||...|...| :..|....::......:.|:.        |.|.....||..
Zfish   148 TELIGEGALPSYEHAHMHLVQTGCEAVPHRATIYAQLVESDMLWK--------WAQMRPIDVDGH 204

  Fly   320 TLHKEG-MKEYFRQPIVDTFDIRICMA-----KSVRHVC-----DFLNDKEDDLHLISIPLEFHI 373
            .|...| ::|....|.|  .||::...     .::..||     ||  .|.......|..:.|..
Zfish   205 RLMPPGAVQECAGAPSV--CDIQLSQVPTDAFTAISPVCTMFSVDF--SKPVSSAAQSYTVRFKS 265

  Fly   374 LQTGICHGLAFWFDVEFSGSSQNV------WLSTSPTA-P-LTHWYQVRCLLPMPIFIKQGQTL 429
            ...|....:..|:|::.......|      |....|.| | ..||.|....||....:.:|:.|
Zfish   266 QTGGRAQVVLSWWDIDMDPEGNIVCTMAPSWSYADPHAYPWRDHWMQSVYFLPAEENVSEGEEL 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_001262445.1 PH-like 24..134 CDD:302622
PRMT5 53..430 CDD:282971 84/324 (26%)
AdoMet_MTases 183..281 CDD:100107 38/105 (36%)
prmt7NP_956797.2 AdoMet_MTases 54..>189 CDD:302624 39/134 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.