DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and CG17807

DIOPT Version :9

Sequence 1:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster


Alignment Length:277 Identity:49/277 - (17%)
Similarity:94/277 - (33%) Gaps:83/277 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRPEEARKLATAASVSPLSNCQFCGVVISSIADEQKLEFTNKYKGSCTLLCSYDSQGVVLRVVSD 68
            :||:....:.:|:.          |:...:......|.|....||.|.  |||.:       :.|
  Fly   293 IRPKHIDVVPSASG----------GLTTQARGKRTSLTFRRLRKGPCD--CSYPA-------LCD 338

  Fly    69 DDRSHVLKEYMIAADTDAAQMGRRSYAVSLDADNLVLRFASEQDQQLFRKVVENVKHLRPKSVFS 133
            ..::.|.:|...:.   |||      |::|:..|:         .:::.|:.::         ||
  Fly   339 TQQTKVPQELHASL---AAQ------AITLEQQNV---------HEVYDKIADH---------FS 376

  Fly   134 QRTEESSASQYFQFYGYLSQQQNMMQDYVRTSTYQRAILGNAVDFQDKIVLDVGAGSGILSFFAV 198
            : |..:...|..:|......|                          .:|||:|.|:|  .:.:.
  Fly   377 E-TRHTPWPQVSEFLDSFEPQ--------------------------SVVLDIGCGNG--KYLSC 412

  Fly   199 QAGAAKVYAIEASNMAQYAQQLVESNNV-QHKISVIPGKIEEIELPEKVDVIISEPMGYMLYNER 262
            ......|....|..:....::  :..|| :....|:|.:...|:....:.||     .::...||
  Fly   413 NPLLLSVGCDRAQGLLAVGRR--KGQNVFRCDCLVVPVRSSSIDGCISIAVI-----HHLATKER 470

  Fly   263 MLETYLHARKWLKPQGK 279
            .|.......:.|:|.|:
  Fly   471 RLAALQEMARVLRPGGR 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_001262445.1 PH-like 24..134 CDD:302622 20/109 (18%)
PRMT5 53..430 CDD:282971 40/228 (18%)
AdoMet_MTases 183..281 CDD:100107 21/98 (21%)
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 136..322 CDD:304390 5/38 (13%)
Methyltransf_11 400..490 CDD:285453 20/97 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.