DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and CG8067

DIOPT Version :9

Sequence 1:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster


Alignment Length:401 Identity:82/401 - (20%)
Similarity:132/401 - (32%) Gaps:138/401 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 SEQDQQLFRKVVENVKHLRPKSVFSQRTEESSASQYFQFYGYLSQQQNM-MQDYVRTSTYQRAIL 172
            ::..|.:|.:   |.|.|        :.|.::.|:....|.||.::... :.|  |....:|   
  Fly    24 TQTSQHIFDR---NAKRL--------QKERAALSEDVGLYDYLKEEIGFRLAD--RVFDIKR--- 72

  Fly   173 GNAVDFQDKIVLDVGAGSGILSFFAVQAGAAKVYAIEAS-NMAQYAQ------------------ 218
                  :.|...|:|...|.||...:.....::...:.| .|.:.||                  
  Fly    73 ------EFKAAADIGCSRGYLSRHILAESVEQLTLTDTSATMLEQAQGTPGLKMVKLVKDEEQLD 131

  Fly   219 ------QLVESNNVQHKISVIPGKIEEIELPEKVDVIISEPM--GYMLYNERMLETYLHARKWLK 275
                  .||.|:...|.::.:||....|:...|.|.:....|  |..||.   |.:.|...: |:
  Fly   132 FEDNSLDLVISSLSLHWVNDLPGCFVRIKQSLKPDGVFIASMFGGDTLYE---LRSSLQLAE-LE 192

  Fly   276 PQGKMYPTHGDLHIAPFSDESLYSEQYNKANF------------WYQSAFHGV-DLTTLHKEGMK 327
            .:|.:.|     ||:||:.........|:|.|            .|.|.|..: ||     :||.
  Fly   193 RKGGISP-----HISPFTQIRDIGSLLNRAGFTMLTIDTDELVIGYPSMFELMWDL-----KGMA 247

  Fly   328 E---YFRQPIVDTFDIRICMAKSVRHVCDFLNDKEDDLHLISIPLEFHILQTGICHGLAFWFDVE 389
            |   .|.:|...:.:..:..:...:.:....|:|       .||..|.|              :.
  Fly   248 ENNAAFNRPAHLSRETMLAASAIYQELYAKPNEK-------GIPATFQI--------------IY 291

  Fly   390 FSGSSQNVWLSTSPTAPLTHWYQVRCLLPMPIFIKQGQTLTGRVLLEANRRQSYDVTIDLHIEGT 454
            |.|     | ...|..            |.|  :::|   ||.|.|:           ||   |:
  Fly   292 FVG-----W-KPGPNQ------------PQP--LERG---TGEVSLK-----------DL---GS 319

  Fly   455 LISSSNTLDLK 465
            :|.....||.|
  Fly   320 IIEKGGKLDTK 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_001262445.1 PH-like 24..134 CDD:302622 5/24 (21%)
PRMT5 53..430 CDD:282971 71/364 (20%)
AdoMet_MTases 183..281 CDD:100107 26/124 (21%)
CG8067NP_001260960.1 BioC 58..296 CDD:273953 57/289 (20%)
Methyltransf_11 79..170 CDD:285453 18/90 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.