DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and Art8

DIOPT Version :9

Sequence 1:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster


Alignment Length:303 Identity:113/303 - (37%)
Similarity:159/303 - (52%) Gaps:53/303 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 ASQYFQFYGYLSQQQNMMQDYVRTSTYQRAILGNAVDFQDKIVLDVGAGSGILSFFAVQAGAAKV 205
            |:.||..|..|...:.|::|..|...|..|||||...|:||||:|||||:||||.|..:|||..|
  Fly     2 ANTYFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLV 66

  Fly   206 YAIEASNMA-QYAQQLVESNNVQHKISVIPGKIEEIELP---EKVDVIISEPMGYMLYNERMLET 266
            ||:||||:| :.|..|:|.|.:.:.:.||..::||..||   ||||:|:||.||:.|.:|.||::
  Fly    67 YAVEASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDS 131

  Fly   267 YLHAR-KWLKPQGKMYPTHGDLHIAPFSDESLYSEQYNKANFWYQSAFHGVDLTTLHKEGMKEYF 330
            .|.|| |:||..|.::|:...:.:||.|..||:.:       |     |.||       |:|   
  Fly   132 VLLARDKFLKEGGLLFPSECTIFVAPCSVPSLFDD-------W-----HNVD-------GIK--- 174

  Fly   331 RQPIVDTFDIRICMAKSVR------------------HVCDFLNDKEDDLHLISIPLEFHILQTG 377
                :|||..::...||.|                  |..:.|:.:..||..|.........:.|
  Fly   175 ----MDTFARKLRTQKSSRPEITQLNPQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAG 235

  Fly   378 ICHGLAFWFDVEFSGSSQNVWLSTSPTAPLTHWYQVRCLLPMP 420
            ...|...||||:|.|  ::..|||||.:|.|||.|  |::.:|
  Fly   236 NHQGFCIWFDVQFPG--EDFVLSTSPLSPPTHWKQ--CVVVLP 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_001262445.1 PH-like 24..134 CDD:302622
PRMT5 53..430 CDD:282971 113/303 (37%)
AdoMet_MTases 183..281 CDD:100107 52/102 (51%)
Art8NP_609478.1 SmtA 1..244 CDD:223574 95/267 (36%)
Methyltransf_18 40..147 CDD:289607 55/106 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440087
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.