DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and prmt1

DIOPT Version :9

Sequence 1:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_956944.2 Gene:prmt1 / 321974 ZFINID:ZDB-GENE-030131-693 Length:348 Species:Danio rerio


Alignment Length:337 Identity:118/337 - (35%)
Similarity:186/337 - (55%) Gaps:25/337 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 SSASQYFQFYGYLSQQQNMMQDYVRTSTYQRAILGNAVDFQDKIVLDVGAGSGILSFFAVQAGAA 203
            :|...||..|.:....:.|::|.|||.||:.::..|...|:||:|||||:|:|||..||.:|||.
Zfish    25 TSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNKHLFKDKVVLDVGSGTGILCMFAAKAGAK 89

  Fly   204 KVYAIEASNMAQYAQQLVESNNVQHKISVIPGKIEEIELP-EKVDVIISEPMGYMLYNERMLETY 267
            ||..||.|:::.||.::|::|.:.|.:::|.||:||:||| |.||:||||.|||.|:.|.||.|.
Zfish    90 KVIGIECSSISDYAVKIVKANKLDHIVTIIKGKVEEVELPVENVDIIISEWMGYCLFYESMLNTV 154

  Fly   268 LHAR-KWLKPQGKMYPTHGDLHIAPFSDESLYSEQYNKANF-WYQSAFHGVDLTTLHKEGMKEYF 330
            ::|| |||||.|.::|....|::....|     .||..... |:::.: |.|::.:.:..:.|  
Zfish   155 IYARDKWLKPDGLIFPDRATLYVTAIED-----RQYKDYKIHWWENVY-GFDMSCIKEVAITE-- 211

  Fly   331 RQPIVDTFDIR-----ICMAKSVRHVCDFLNDKEDDLHLISIPLEFHILQTGICHGLAFWFDVEF 390
              |:||..|.:     .|:.|.|    |....|.:||...| |....:.:....|.|..:|::||
Zfish   212 --PLVDVVDPKQLVSTACLIKEV----DIYTVKIEDLSFTS-PFCLQVKRNDYIHALVTYFNIEF 269

  Fly   391 SGSSQNVWLSTSPTAPLTHWYQVRCLLPMPIFIKQGQTLTGRVLLEAN--RRQSYDVTIDLHIEG 453
            :...:....||||.:|.|||.|....|...:.:|.|:.:.|.:.::.|  ..:..|.|:|:..:|
Zfish   270 TRCHKRTGFSTSPESPYTHWKQTVFYLDDYLTVKTGEEIFGTISMKPNVKNNRDLDFTVDIDFKG 334

  Fly   454 TLISSSNTLDLK 465
            .|...|.|.:.:
Zfish   335 QLCEVSKTSEYR 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_001262445.1 PH-like 24..134 CDD:302622
PRMT5 53..430 CDD:282971 109/298 (37%)
AdoMet_MTases 183..281 CDD:100107 55/99 (56%)
prmt1NP_956944.2 Methyltransf_18 65..169 CDD:289607 57/103 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.