DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and CG32152

DIOPT Version :9

Sequence 1:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001287079.2 Gene:CG32152 / 317885 FlyBaseID:FBgn0052152 Length:527 Species:Drosophila melanogaster


Alignment Length:313 Identity:85/313 - (27%)
Similarity:147/313 - (46%) Gaps:24/313 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LSQQQNMMQDYVRTSTYQRAILGNAVDFQDKIVLDVGAGSGILSFFAVQAGAAKVYAIEASNMAQ 215
            |...:|..:|......:|..|.......:|:.:|.:..|:|.|:..|.|.||.:|||::.|.:..
  Fly   184 LDVMRNRQKDQAHMYFFQSVIHHQRHLIKDRTILVLCCGTGTLALMAAQMGAKRVYAVDYSKVTG 248

  Fly   216 YAQQLVESNNVQHKISVIPGKIEEIELPEKVDVIISEPMGY-MLYNERMLETYLHAR-KWLKPQG 278
            |...:|..|..:..|:|:.|::::::||.|||.||...||| :||...:||. |.|| :|||..|
  Fly   249 YTTLVVRQNGYEGVITVMNGRMKDLKLPTKVDGIICNWMGYCLLYESEILEV-LEARDRWLKKGG 312

  Fly   279 KMYPTHGDLHIAPFSDESLYSEQYNKANFWYQSAFHGVDLTTLHKEGMKEYFRQPIV--DTFDIR 341
            .:.|....|::....:..|.||   :.|.|..  .:|.::..:.:..:.|    |.|  .|....
  Fly   313 FILPDLAALYLVASEEHKLKSE---RCNHWRN--VYGFNMNAIRRYALAE----PCVALTTGKKL 368

  Fly   342 ICMAKSVRHVCDFLNDKEDDLHLISIPLEFHILQTGICHGLAFWFDVEFSGSSQNVWLSTSP--T 404
            :.||..|..: |....:.:|| .|...:...:.:.|.......:|:|:|| :|.|..||.:|  .
  Fly   369 LTMAHCVLRL-DLKRARREDL-FIDRNIRLSVNREGYLECFLLFFEVQFS-NSLNFKLSCNPCLK 430

  Fly   405 APL-THWYQVRCLLPMPIFIKQGQTLTGRV---LLEANRRQSYDVTIDLHIEG 453
            :|. :.|.|....:..|..:::....||.:   .|:.|:....::.|:.: ||
  Fly   431 SPFKSLWMQSVLFVEQPFVMRKNIHYTGNLKFKTLKPNKFNEMEICIEFY-EG 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_001262445.1 PH-like 24..134 CDD:302622
PRMT5 53..430 CDD:282971 78/285 (27%)
AdoMet_MTases 183..281 CDD:100107 39/99 (39%)
CG32152NP_001287079.2 AdoMet_MTases 215..315 CDD:100107 39/100 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440096
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.