DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and Ndufaf5

DIOPT Version :9

Sequence 1:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001119843.1 Gene:Ndufaf5 / 296190 RGDID:1309829 Length:343 Species:Rattus norvegicus


Alignment Length:191 Identity:40/191 - (20%)
Similarity:71/191 - (37%) Gaps:54/191 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 QQQNMMQDYVRTSTYQR---AILGNAVDFQDKIVLDVGAGSGILSFFAVQAGAAKVYAIEASNMA 214
            |.:.|..||::.....|   .:...|.||  .:.||:|.|.|.::....:....|::   .:::|
  Rat    62 QPEPMKFDYLKEEIGSRIADRVYDIARDF--PLALDIGCGRGYIAQHLNKETVGKIF---QTDIA 121

  Fly   215 QYAQQ---------------------------LVESNNVQHKISVIPGKIEEIELPEKVDVIISE 252
            ::|.:                           ||.|:...|.::.:|..:|:|....|.|.:...
  Rat   122 EHALKNSIETDIPTVNILADEEFLPFPENTFDLVVSSLSLHWVNDLPRALEQIHYVLKPDGVFVG 186

  Fly   253 PM--GYMLYNER----MLETYLHARKWLKPQGKMYPTHGDLHIAPFSDESLYSEQYNKANF 307
            .|  |..||..|    :.||        :.:|...|     ||:||:..:.......:|.|
  Rat   187 AMFGGDTLYELRCSLQLAET--------EREGGFSP-----HISPFTAVNDLGHLLGRAGF 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_001262445.1 PH-like 24..134 CDD:302622
PRMT5 53..430 CDD:282971 40/191 (21%)
AdoMet_MTases 183..281 CDD:100107 25/130 (19%)
Ndufaf5NP_001119843.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..40
BioC 74..310 CDD:273953 36/179 (20%)
Methyltransf_11 94..185 CDD:285453 17/93 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.