powered by:
Protein Alignment Art4 and C35D10.12
DIOPT Version :9
Sequence 1: | NP_001262445.1 |
Gene: | Art4 / 41219 |
FlyBaseID: | FBgn0037770 |
Length: | 530 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_498018.1 |
Gene: | C35D10.12 / 183240 |
WormBaseID: | WBGene00016448 |
Length: | 365 |
Species: | Caenorhabditis elegans |
Alignment Length: | 53 |
Identity: | 17/53 - (32%) |
Similarity: | 24/53 - (45%) |
Gaps: | 18/53 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 155 QNMMQDYV-----RTSTYQR--------AILGNAVDFQDK-----IVLDVGAG 189
:|:.|:|| |.:|||: .|......|.|: |:||||.|
Worm 6 ENVEQEYVHSIYSRLATYQQKEHKPSSPRIWPRVRQFVDQQSAGSIILDVGCG 58
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0500 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.