DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and prmt-1

DIOPT Version :9

Sequence 1:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_507909.1 Gene:prmt-1 / 180326 WormBaseID:WBGene00013766 Length:348 Species:Caenorhabditis elegans


Alignment Length:328 Identity:118/328 - (35%)
Similarity:181/328 - (55%) Gaps:28/328 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 EESSASQYFQFYGYLSQQQNMMQDYVRTSTYQRAILGNAVDFQDKIVLDVGAGSGILSFFAVQAG 201
            |.:|...||..|.:....:.|::|.|||:||:.:|..|:..|:||:|:|||:|:||||.||.:||
 Worm    20 ELTSKDYYFDSYAHFGIHEEMLKDEVRTTTYRNSIYHNSHLFKDKVVMDVGSGTGILSMFAAKAG 84

  Fly   202 AAKVYAIEASNMAQYAQQLVESNNVQHKISVIPGKIEEI-ELP---EKVDVIISEPMGYMLYNER 262
            |.||:|:|.||||..:::::..||:.|.:.||..|:|:: |||   ||||:||||.|||.|:.|.
 Worm    85 AKKVFAMEFSNMALTSRKIIADNNLDHIVEVIQAKVEDVHELPGGIEKVDIIISEWMGYCLFYES 149

  Fly   263 MLETYLHAR-KWLKPQGKMYPTHGDLHIAPFSDESLYSEQYNKANFWYQSAFHGVDLTTLHKEGM 326
            ||.|.|.|| :||.|.|.::|....|::....|.. |.|  :|.::|  .:.:|.:::.:....:
 Worm   150 MLNTVLVARDRWLAPNGMLFPDKARLYVCAIEDRQ-YKE--DKIHWW--DSVYGFNMSAIKNVAI 209

  Fly   327 KEYFRQPIVDTFD-----IRICMAKSVRHVCDFLNDKEDDLHLISIPLEFHILQTGICHGLAF-- 384
            ||    |:||..|     ...|:.|.|    |....|.:||...|   :|.:..|...:..||  
 Worm   210 KE----PLVDIVDNAQVNTNNCLLKDV----DLYTVKIEDLTFKS---DFKLRCTRSDYIQAFVT 263

  Fly   385 WFDVEFSGSSQNVWLSTSPTAPLTHWYQVRCLLPMPIFIKQGQTLTGRVLLEANRRQSYDVTIDL 449
            :|.||||...:....||.|....|||.|....|...:.:|:|:.:||...:..|:....|:.|::
 Worm   264 FFTVEFSKCHKKTGFSTGPDVQYTHWKQTVFYLKDALTVKKGEEITGSFEMAPNKNNERDLDINI 328

  Fly   450 HIE 452
            ..:
 Worm   329 SFD 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_001262445.1 PH-like 24..134 CDD:302622
PRMT5 53..430 CDD:282971 113/304 (37%)
AdoMet_MTases 183..281 CDD:100107 55/102 (54%)
prmt-1NP_507909.1 AdoMet_MTases 66..169 CDD:100107 55/102 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.