DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and C27F2.4

DIOPT Version :9

Sequence 1:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_498051.1 Gene:C27F2.4 / 175671 WormBaseID:WBGene00016166 Length:283 Species:Caenorhabditis elegans


Alignment Length:423 Identity:80/423 - (18%)
Similarity:128/423 - (30%) Gaps:183/423 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 KHLRPKSVFSQRTEESSASQYFQFYGYLSQQQNMMQDYVRTSTYQRAI-LGNAVDFQDKIVLDVG 187
            :|..|..::...||   |::|.......:.|..|.         :||: |....:.:...:||:|
 Worm     9 EHTGPPDLYYNETE---AAKYASNSHITAIQHEMA---------ERALELLALPEGKSGFLLDIG 61

  Fly   188 AGSGILSFFAVQAGAAKVYAIEASNMAQYAQQ--LVESNNVQHKISVIPGKIEEIEL-----PEK 245
            .|:|:.|...:.||...|....:..|.:.|:|  .:||.:..|         :::.|     |..
 Worm    62 CGTGMSSEVILDAGHMFVGVDVSRPMLEIARQDEDLESGDFIH---------QDMGLGMPFRPGS 117

  Fly   246 VDVIISEPMGYMLYNERMLETYLHARKWLKPQGKMYPTHGDLHIAPFSDESLYSEQYNKANFWYQ 310
            .|..||                :.|.:||            .| |..|||:    ...:..|::|
 Worm   118 FDGAIS----------------ISAIQWL------------CH-ANASDEN----PRKRLLFFFQ 149

  Fly   311 SAFHGVDLTTLHKEGMKEYFRQPIVDTFDIRICMAKSVRHVCDFL--NDKEDDLHLISIPLEFHI 373
            |.:.                            |:.:..|.|..|.  ||::.||    |..:.| 
 Worm   150 SLYG----------------------------CLGRGSRAVFQFYPENDEQCDL----IMGQAH- 181

  Fly   374 LQTGICHGLAFWFDVEFSGSSQNVWLSTSPTAPLTHWYQVRCLLPMPIFIKQGQTLTGRVLLEAN 438
             :.|...||.    |:|            |.|                               |.
 Worm   182 -KAGFNGGLV----VDF------------PEA-------------------------------AK 198

  Fly   439 RRQSYDVTIDLHIEGTLISSSNTLDLKNPYFRYTGAPVQAPPGTSTQSPSEQYWTQVDTQG---- 499
            |::.|.|.:                        ||..||.|...:  ...|:..||:|..|    
 Worm   199 RKKVYLVLM------------------------TGGVVQLPQALT--EDGEESRTQIDNAGRRFV 237

  Fly   500 --SRNSSSMLNGGIS------VNGIGEGMDITH 524
              ||.:..:..|..:      ...|.:|.|:.|
 Worm   238 WNSRKNEKVAKGSKAWIEAKRQRQIKQGRDVRH 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_001262445.1 PH-like 24..134 CDD:302622 2/9 (22%)
PRMT5 53..430 CDD:282971 59/315 (19%)
AdoMet_MTases 183..281 CDD:100107 23/104 (22%)
C27F2.4NP_498051.1 SmtA 23..253 CDD:223574 72/387 (19%)
Methyltransf_11 58..163 CDD:285453 33/174 (19%)
WBS_methylT 206..281 CDD:289366 17/91 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.