DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and strm-1

DIOPT Version :9

Sequence 1:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_497549.2 Gene:strm-1 / 175358 WormBaseID:WBGene00019198 Length:334 Species:Caenorhabditis elegans


Alignment Length:381 Identity:65/381 - (17%)
Similarity:119/381 - (31%) Gaps:133/381 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 AVSLDADNLVL----------RFASEQDQQLFRKVVENVKHLR---------------------- 127
            :::::|:.|.|          .|.||.| .|:.|.:|...||.                      
 Worm     2 SINMNANFLKLLTHFRRHDLTNFKSEHD-TLYEKALETGDHLEVTSHYYSVMSTVIDEYFGGNFH 65

  Fly   128 --PKSVFSQRTEESSASQYFQFYGYLSQQQNMMQDYVRTSTYQRAILGNAVDFQDKIVLDVGAGS 190
              |.....|:.||:..|.:......|...:|:.                        .||:|.|.
 Worm    66 FVPPKFEGQKLEEALKSLHCHIAEKLELSENVH------------------------CLDIGCGI 106

  Fly   191 GILSFFAVQAGAAKVYAIEASNMAQYAQQLVESNNVQHKISVIPGKIEEIELPEKV-DVIISEPM 254
            |.:.......||.......|.|.|:...:...:..:..:..::....:::...:.. ||      
 Worm   107 GGVMLDIADFGAKLTGVTIAPNEAEIGNEKFANMGISDRCKIVAADCQKMPFEDSTFDV------ 165

  Fly   255 GYMLYNERML----ETYLHARKWLKPQGK--MYPTHGDLHIAPFSDESLYSEQYNKANFWYQSAF 313
            .|.:|:.:.:    :.....::.|||.||  :|    ||         :.:..|:|.|..:....
 Worm   166 AYAIYSLKYIPNLDKVMKEIQRVLKPGGKFIVY----DL---------IKTNDYDKDNKEHYKTL 217

  Fly   314 HGVD----LTTLHK----EGMKEYFRQPIVDTFDIRICMAKSVRHVCDFLNDKEDDLHLISIPLE 370
            |.::    :.:||.    |...|.:..|:|:..::.........|.|                  
 Worm   218 HHLEYACGMPSLHTQSEVEAAAEKWEMPVVERENLEETYGNRAFHYC------------------ 264

  Fly   371 FHILQTGICHGLAFWFDVEFSGSSQNVWLSTSPTAPLTHWYQVRCLLP-MPIFIKQ 425
                               ||.|...:||.:||.  :.|..::..:|. :|...||
 Worm   265 -------------------FSASPMFMWLVSSPV--IDHTIRMAEILRILPAGFKQ 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_001262445.1 PH-like 24..134 CDD:302622 13/72 (18%)
PRMT5 53..430 CDD:282971 65/381 (17%)
AdoMet_MTases 183..281 CDD:100107 19/104 (18%)
strm-1NP_497549.2 Methyltransf_11 100..197 CDD:285453 19/102 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.