DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and Prmt1

DIOPT Version :9

Sequence 1:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_062804.1 Gene:Prmt1 / 15469 MGIID:107846 Length:371 Species:Mus musculus


Alignment Length:376 Identity:130/376 - (34%)
Similarity:200/376 - (53%) Gaps:29/376 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 DNLVLRFASEQDQQLFRKVVENVKHLRPKSVFSQRTEE-SSASQYFQFYGYLSQQQNMMQDYVRT 164
            :|.|...|:....|   ..:|.|...:.:|......|: :|...||..|.:....:.|::|.|||
Mouse    12 ENFVATLANGMSLQ---PPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRT 73

  Fly   165 STYQRAILGNAVDFQDKIVLDVGAGSGILSFFAVQAGAAKVYAIEASNMAQYAQQLVESNNVQHK 229
            .||:.::..|...|:||:|||||:|:|||..||.:|||.||..||.|:::.||.::|::|.:.|.
Mouse    74 LTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHV 138

  Fly   230 ISVIPGKIEEIELP-EKVDVIISEPMGYMLYNERMLETYLHAR-KWLKPQGKMYPTHGDLHIAPF 292
            :::|.||:||:||| ||||:||||.|||.|:.|.||.|.|||| |||.|.|.::|....|::...
Mouse   139 VTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLHARDKWLAPDGLIFPDRATLYVTAI 203

  Fly   293 SDESLYSEQYNKANF-WYQSAFHGVDLTTLHKEGMKEYFRQPIVDTFD-----IRICMAKSVRHV 351
            .|     .||..... |:::.: |.|::.:....:||    |:||..|     ...|:.|.|   
Mouse   204 ED-----RQYKDYKIHWWENVY-GFDMSCIKDVAIKE----PLVDVVDPKQLVTNACLIKEV--- 255

  Fly   352 CDFLNDKEDDLHLISIPLEFHILQTGICHGLAFWFDVEFSGSSQNVWLSTSPTAPLTHWYQVRCL 416
             |....|.:||...| |....:.:....|.|..:|::||:...:....||||.:|.|||.|....
Mouse   256 -DIYTVKVEDLTFTS-PFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFY 318

  Fly   417 LPMPIFIKQGQTLTGRVLLEANRRQSYDV--TIDLHIEGTLISSSNTLDLK 465
            :...:.:|.|:.:.|.:.:..|.:.:.|:  ||||..:|.|...|.:.|.:
Mouse   319 MEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYR 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_001262445.1 PH-like 24..134 CDD:302622 7/32 (22%)
PRMT5 53..430 CDD:282971 119/337 (35%)
AdoMet_MTases 183..281 CDD:100107 57/99 (58%)
Prmt1NP_062804.1 AdoMet_MTases 92..192 CDD:100107 57/99 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.