DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and Prmt9

DIOPT Version :9

Sequence 1:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001074709.1 Gene:Prmt9 / 102182 MGIID:2142651 Length:846 Species:Mus musculus


Alignment Length:458 Identity:111/458 - (24%)
Similarity:192/458 - (41%) Gaps:129/458 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 MGRRSYAVSLDADNLVLRFASEQDQQLFR------------KVVENVKHLRPKSVFSQRTEESSA 141
            :|....|:.|..|:.|:  .:...:.|||            |.|:    |.|.  |:...|    
Mouse    87 LGCYEQALELFPDDEVI--CNSMGEHLFRMGFRDEAAGYFHKAVK----LNPD--FNDAKE---- 139

  Fly   142 SQYFQFYGYLSQQQN--MMQDYVRTSTYQRAILGNAVDFQDKIVLDVGAGSGILSFFAVQAGAAK 204
             .:::...:|.::.:  |:.|..|...|..|| ..||....:.|||:|.|:||||.||.:|||..
Mouse   140 -NFYRVANWLVERWHFIMLNDTRRNMVYNAAI-QKAVCLGSRTVLDIGTGTGILSMFAKKAGAQS 202

  Fly   205 VYAIEAS-NMAQYAQQLVESNNVQHKISVIPGKIEEIE----LPEKVDVIISEPMGYMLYNERML 264
            |||.|.| .|.:.|..:|.:|.:::.|.::..|..:||    :||:|.::::|.:...::.|.::
Mouse   203 VYACELSKTMYELACDVVAANKMENGIKLLHMKSLDIEIPKHIPERVSLVVTETVDAGVFGEGIV 267

  Fly   265 ETYLHARKW----LKPQ-----------GKMYPTHGDLHIAPFSDESLYSEQYNK---------- 304
            |:.:||  |    |:|:           ||:.|. |.: |...:.|.....::::          
Mouse   268 ESLIHA--WEHLLLQPKTKEENGNCGKYGKVIPA-GAV-IFGMAVECAEIRRHHRVGAKDIAGIH 328

  Fly   305 --ANFWYQS-AFHGVDLTTLHKEGMKEYFRQ----------PIVDTFDIRICMAKSVRHVCDFLN 356
              .|..:|| |:..||.    :|.::.|..:          |:.:.|.|......:::.:.....
Mouse   329 LPTNVKFQSPAYTSVDT----EETVEPYTTEKMSGIPGGYLPLTECFQIMKVDFNNLQELKSLAT 389

  Fly   357 DKEDDLHLISIPLEFHILQTGICHGLAFWF----DVEFSGSSQNVWLSTSPTAPLTHW----YQV 413
            .|.   |.:::|    .::.|:...:..||    |.|:|       |||||:.. |.|    |.|
Mouse   390 KKP---HSLNVP----AIKEGVLDAIMVWFVLQLDDEYS-------LSTSPSEE-TCWEQAVYPV 439

  Fly   414 R-----CLLPMPIFIKQGQTLTGRVLLEANRRQSY----DVTIDLHIEGTL------ISSSNTLD 463
            :     |:.|           ..||.:||:....|    .::| ||:|..:      ..|.:.|.
Mouse   440 QALEDYCIQP-----------GDRVTMEASCHDCYLRIQGISI-LHLEHEMEVMKGFTKSKDLLS 492

  Fly   464 LKN 466
            |.|
Mouse   493 LGN 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_001262445.1 PH-like 24..134 CDD:302622 13/56 (23%)
PRMT5 53..430 CDD:282971 98/410 (24%)
AdoMet_MTases 183..281 CDD:100107 40/117 (34%)
Prmt9NP_001074709.1 TPR 1 25..58
TPR 2 67..100 3/12 (25%)
TPR_11 68..132 CDD:290150 11/50 (22%)
TPR repeat 68..95 CDD:276809 2/7 (29%)
TPR repeat 100..130 CDD:276809 6/35 (17%)
TPR 3 101..134 8/40 (20%)
AdoMet_MTases 148..>303 CDD:302624 51/159 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.