DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art4 and PRMT3

DIOPT Version :10

Sequence 1:NP_649963.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_005779.1 Gene:PRMT3 / 10196 HGNCID:30163 Length:531 Species:Homo sapiens


Alignment Length:60 Identity:19/60 - (31%)
Similarity:32/60 - (53%) Gaps:2/60 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly  1077 DYMRVVLLTQFGANFFSQLIASVSDFTKAQIAAENVMRVI--REPPVDMDNLSEEGLRPK 1134
            |..:...|:..|||:.|.|..:.....|.|.|.|...:::  |..|:::|:||::.||.|
Human   135 DMKKKKALSSMGANYSSYLAKADQKRGKKQTAREMKKKILAERRKPLNIDHLSDDKLRDK 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art4NP_649963.1 PH-like 24..134 CDD:473070
COG4076 154..341 CDD:443253
PRMT3NP_005779.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Interaction with ZNF200. /evidence=ECO:0000269|PubMed:39513743 48..71
zf-C2H2_2 50..>99 CDD:463690
Mediates interaction with ALDH1A1. /evidence=ECO:0000269|PubMed:33495566 186..531 5/9 (56%)
COG4076 230..>393 CDD:443253
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.