DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Teh1 and Teh3

DIOPT Version :9

Sequence 1:NP_001262442.1 Gene:Teh1 / 41215 FlyBaseID:FBgn0037766 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_652335.1 Gene:Teh3 / 50170 FlyBaseID:FBgn0040697 Length:448 Species:Drosophila melanogaster


Alignment Length:267 Identity:58/267 - (21%)
Similarity:94/267 - (35%) Gaps:103/267 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 FSVTAGASLLFLVPLYVDPAISTLSHDFIEKPTLCTTTRRE----DLVGIFNCSWSSCRE----- 109
            |:.|||..      |.:..|...:.|: .:.|..|:..|.:    |:.|:::||..:||:     
  Fly   144 FNCTAGQC------LNITDAFECIFHN-SDAPVKCSGRRGKINCMDISGLYSCSRGTCRKIRTPY 201

  Fly   110 GCTSDLYRCVHI---------------YVTFIEQNI----------------------------- 130
            .|..   |||.|               |::..:..|                             
  Fly   202 NCDR---RCVDIPTRNKNVVVLSGDKVYLSQCQNAINAETLEEVWNESSENVAMTSCYFIRHTSD 263

  Fly   131 -----------TIPENM-TDYSNFT--------------------SDMEQSGEATLLVNIKGCGY 163
                       |:..|| :|.:|||                    .|:..|.|:.|::|::||..
  Fly   264 QVDAVDCINGSTLETNMLSDLTNFTYLSHLHVSVATPVPEIAPPDVDLTISNESKLMINLEGCVN 328

  Fly   164 PPSVTCKNFNGYYGIEG------AIFPCFYSRKNKTVVLTSYNHDDQVAMIIHFFAVPFVITVIS 222
            .....||.|...:|.:|      |.||||||...|.||:..::.:......:....||.|:.|:|
  Fly   329 TLMDECKEFLKDFGRDGSDHNARARFPCFYSPGKKDVVVARFDLEVTYRQFVFASVVPSVLFVVS 393

  Fly   223 S--IALC 227
            .  :.:|
  Fly   394 CSILIMC 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Teh1NP_001262442.1 TipE 37..>221 CDD:293577 55/257 (21%)
Teh3NP_652335.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469575
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12335
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.