DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Teh1 and tipE

DIOPT Version :9

Sequence 1:NP_001262442.1 Gene:Teh1 / 41215 FlyBaseID:FBgn0037766 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_523920.1 Gene:tipE / 38504 FlyBaseID:FBgn0003710 Length:452 Species:Drosophila melanogaster


Alignment Length:293 Identity:82/293 - (27%)
Similarity:111/293 - (37%) Gaps:115/293 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RSWRERARFYGTSTLAFFSVTAGASL---LFLVPLYVDPAISTLSHDFIEKPTLCTTTRREDLVG 98
            |:.:|:..||   |.|||.:....||   |||||..::||.:|:...|.|.|.||.|...|...|
  Fly     8 RTGKEKLLFY---TTAFFILLGTFSLFAFLFLVPFVIEPAFTTIFMQFEEVPALCETYDTEIYYG 69

  Fly    99 IFNCSWSSCREGCTSDLYRCVHIYVTFIEQNITIPENMTDYSNFT-------------------- 143
            ..||||||||||||.|:|.|..|.|.: ..|:   .|.||..|||                    
  Fly    70 AKNCSWSSCREGCTKDIYTCTQIRVNY-RLNL---YNFTDEFNFTEYHINLKEAERILPPVKRTD 130

  Fly   144 -------SD--------------------MEQ-------------------------SGE----- 151
                   ||                    |||                         ||.     
  Fly   131 RYERALRSDYEYDNLGGGTGLDIDLGAGRMEQLNFGDADGSNGYLIEDSEDTRGLSASGTLISDE 195

  Fly   152 -------------------------ATLLVNIKGCGYPPSVTCKNFNGYYGIEGAIFPCFYSRKN 191
                                     |.|..|:|||||||.:.|..:...|...|..|||:||:.:
  Fly   196 RRPFDEISELNEGLMGNRSMYYYVGARLFPNVKGCGYPPMLNCTIWLKRYTKIGMKFPCYYSKVD 260

  Fly   192 KTVVLTSYNHDDQVAMIIHFFAVP---FVITVI 221
            .::|::..::......:::..|:|   |:|:||
  Fly   261 PSLVISDLDYWQNTLNLVYSMAIPIPSFIISVI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Teh1NP_001262442.1 TipE 37..>221 CDD:293577 80/291 (27%)
tipENP_523920.1 TipE 1..452 CDD:293577 82/293 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469574
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CJ08
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394377at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12335
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.