DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Teh1 and Teh4

DIOPT Version :9

Sequence 1:NP_001262442.1 Gene:Teh1 / 41215 FlyBaseID:FBgn0037766 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_647866.2 Gene:Teh4 / 38501 FlyBaseID:FBgn0035504 Length:524 Species:Drosophila melanogaster


Alignment Length:187 Identity:46/187 - (24%)
Similarity:72/187 - (38%) Gaps:56/187 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 TLCTTTRREDLVGIFNCSWSSCREGCTSDLYRCVHIYVTFIEQNITIPENMTDYSNFTSDMEQSG 150
            |.|.|..||          |..|...|.    |::  .|.:|.: |:|....:::.|.:..|.|.
  Fly   257 TNCATVTRE----------SDNRITATD----CIN--GTLLEHD-TLPAPFMNFTQFWAIYENST 304

  Fly   151 EAT--------------------LLVNIKGCGYPPSVTCKNFNGYYGIEG------AIFPCFYSR 189
            .:.                    |.:|::||.......||:|...||.:|      :.:.|:|::
  Fly   305 RSVDPEQRYLPNQANLTIYSWKKLFINLEGCVNTLRGECKDFVARYGNDGDNNTAQSRYQCYYNK 369

  Fly   190 -KNKTVVLTSYNHDDQVAMIIHFFAVPFVITVISSIALCI------------MHCDC 233
             .|...|:..|:.|.....::....||.|:.|||||:|||            |.|.|
  Fly   370 DSNVEFVVARYDLDKVYRELLVSLIVPIVLFVISSISLCIITKSVKVGDDAKMRCVC 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Teh1NP_001262442.1 TipE 37..>221 CDD:293577 35/161 (22%)
Teh4NP_647866.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469576
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12335
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.