DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9458 and AT1G75000

DIOPT Version :9

Sequence 1:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_177637.1 Gene:AT1G75000 / 843838 AraportID:AT1G75000 Length:281 Species:Arabidopsis thaliana


Alignment Length:151 Identity:34/151 - (22%)
Similarity:68/151 - (45%) Gaps:21/151 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 WLTYSYFFNKLLDLLETVFFVLRKKDRQISFLHVFHHMYMLYFSFMYLYYYGYGGHGF--FMCFF 169
            | :|:::.::.|.|..|.|.|:|:  |::||..:.:...:|..||::|.|    ...|  .....
plant   129 W-SYAFYLSRFLHLFRTFFSVIRR--RKLSFFQLINQSSLLCISFLWLEY----SQSFQVVAILL 186

  Fly   170 NVVVHIMMYSYYYQSSLNRDSKGDLWWKKYITIVQLIQFG-IVLGH----SIYTLKQPDCPSARF 229
            ..|.:.::|.|.:.:.:.  .:|..:  .::...|.|..| :.:.|    .|:.:|:..|..  .
plant   187 TTVSYAVVYGYRFWTEIG--LRGACF--PFVGNCQAILLGCMTVCHVGVLCIHLVKRGGCNG--I 245

  Fly   230 SATCAGSI-SVVFIILFSNFY 249
            .|....|: :.|..:|:..||
plant   246 GAWLFNSVLNAVITLLYLKFY 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9458NP_731419.1 ELO 20..261 CDD:279492 34/151 (23%)
AT1G75000NP_177637.1 ELO 26..276 CDD:395916 34/151 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.