DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9458 and ELOVL3

DIOPT Version :9

Sequence 1:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_689523.1 Gene:ELOVL3 / 83401 HGNCID:18047 Length:270 Species:Homo sapiens


Alignment Length:250 Identity:67/250 - (26%)
Similarity:117/250 - (46%) Gaps:24/250 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ASHKPVLMVLATYLFFVKIAGPKIMRNRKPFDLRGLIKAYNIMQIVYNVI----MCFFAVHFMLG 83
            |:..|:.::   ||..:.: |...|:.||.|:|:|.:..::....:::::    |.......:|.
Human    35 ATSFPIALI---YLVLIAV-GQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLT 95

  Fly    84 PGDYNFKCIKNLPPDHEYKTWERWLTYSYFFNKLLDLLETVFFVLRKKDRQISFLHVFHHMYML- 147
            .|.....|..|...:...|.|. |:   :..:|:::|.:|.|.:|||  |.:.|:|.:||..:| 
Human    96 GGLKQTVCFINFIDNSTVKFWS-WV---FLLSKVIELGDTAFIILRK--RPLIFIHWYHHSTVLV 154

  Fly   148 YFSFMYLYYYGYGGHGFFMCFFNVVVHIMMYSYYYQSSLNRDSKGDLWWKKYITIVQLIQF--GI 210
            |.||.|......||   :....|..||.:||:||...:.|  .|........||.:|::|.  |.
Human   155 YTSFGYKNKVPAGG---WFVTMNFGVHAIMYTYYTLKAAN--VKPPKMLPMLITSLQILQMFVGA 214

  Fly   211 VLGHSIYTLKQPD-CPSARFSATCAGSISVVFIILFSNFYFHAYIRPK-KRKQKN 263
            ::....|..:|.. |.:.......:..:.:.:.|||::|:...||||| |.|.|:
Human   215 IVSILTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIRPKVKAKTKS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9458NP_731419.1 ELO 20..261 CDD:279492 65/246 (26%)
ELOVL3NP_689523.1 ELO 29..266 CDD:307345 65/245 (27%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03203 266..270 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.