DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9458 and AT3G06470

DIOPT Version :9

Sequence 1:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_187298.1 Gene:AT3G06470 / 819824 AraportID:AT3G06470 Length:278 Species:Arabidopsis thaliana


Alignment Length:272 Identity:59/272 - (21%)
Similarity:114/272 - (41%) Gaps:74/272 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VLMVLATYL---FFVKIA-------GPKIMRNRKPFDLRGLIKAYNIMQIVYNVIMCFFAVHFML 82
            |.:|::.||   |.::.|       .|:|:   ||            :..|:::|:|..::...:
plant    36 VSVVVSVYLSATFLLRSAIDSLPSLSPRIL---KP------------ITAVHSLILCLLSLVMAV 85

  Fly    83 GPGDYNFKCIKNLPPDH-EYKTWERWL------------------TYSYFFNKLLDLLETVFFVL 128
            |       |..::...| ......|:|                  ...::.:|:|:..:|:..:|
plant    86 G-------CTLSITSSHASSDPMARFLHAICFPVDVKPNGPLFFWAQVFYLSKILEFGDTILIIL 143

  Fly   129 RKKDRQISFLHVFHHMYMLYFSFMYLYYYGYGGHGFF--MCFFNVVVHIMMYSYYYQSSLNRDSK 191
            .|..:::|||||:||..::...:::|    ......|  ....|..||::||.||:..::....|
plant   144 GKSIQRLSFLHVYHHATVVVMCYLWL----RTRQSMFPIALVTNSTVHVIMYGYYFLCAVGSRPK 204

  Fly   192 GDLWWKKYITIVQLIQFGIVLGHSIYTLKQPDCPSARFSATCAG--------SISVVFIILFSNF 248
                ||:.:|..|::||....|.|.:.|::     ..|.:.|.|        :.:...:.|||||
plant   205 ----WKRLVTDCQIVQFVFSFGLSGWMLRE-----HLFGSGCTGIWGWCFNAAFNASLLALFSNF 260

  Fly   249 YFHAYIRPKKRK 260
            :...|::...|:
plant   261 HSKNYVKKPTRE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9458NP_731419.1 ELO 20..261 CDD:279492 59/272 (22%)
AT3G06470NP_187298.1 ELO 43..272 CDD:395916 56/263 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3313
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.