DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9458 and Elovl1

DIOPT Version :9

Sequence 1:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001037740.1 Gene:Elovl1 / 679532 RGDID:1587151 Length:279 Species:Rattus norvegicus


Alignment Length:255 Identity:95/255 - (37%)
Similarity:136/255 - (53%) Gaps:33/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PLLASHKPVLMVLATYLFFVKIAGPKIMRNRKPFDLRGLIKAYNI------MQIVYNVIMCFFAV 78
            ||:.|...:..:|.||::||...||:||.|||||.|||.:..||.      :.|||..:|..:. 
  Rat    23 PLMGSPLLITSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLVTLSLYIVYEFLMSGWL- 86

  Fly    79 HFMLGPGDYNFKC----IKNLPPDHEYKTWER--WLTYSYFFNKLLDLLETVFFVLRKKDRQISF 137
                  ..|.::|    ..|.|   |.....|  ||   :..:|:::|::||.|:|||||.|::|
  Rat    87 ------STYTWRCDPVDFSNNP---EALRMVRVAWL---FMLSKVIELMDTVIFILRKKDGQVTF 139

  Fly   138 LHVFHHMYMLYFSFMYLYYYGYGGHGFFMCFFNVVVHIMMYSYYYQSSLNRDSKGDLWWKKYITI 202
            ||||||. :|.:|:.:......||.|.|....|..||::||.||..|:|...::..|||||::|.
  Rat   140 LHVFHHS-VLPWSWWWGIKIAPGGMGSFHAMINSSVHVVMYLYYGLSALGPVAQPYLWWKKHMTA 203

  Fly   203 VQLIQFGIVLGHSIYTLKQPDC----PSARFSATCAGSISVVFIILFSNFYFHAYIRPKK 258
            :|||||.:|..|.......|.|    |.........|:|   |.||||||::|:|.:.|:
  Rat   204 IQLIQFVLVSLHISQYYFMPSCNYQYPIIIHLIWMYGTI---FFILFSNFWYHSYTKGKR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9458NP_731419.1 ELO 20..261 CDD:279492 95/255 (37%)
Elovl1NP_001037740.1 ELO 23..260 CDD:395916 94/253 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.