DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9458 and ELOVL4

DIOPT Version :9

Sequence 1:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_073563.1 Gene:ELOVL4 / 6785 HGNCID:14415 Length:314 Species:Homo sapiens


Alignment Length:261 Identity:97/261 - (37%)
Similarity:141/261 - (54%) Gaps:44/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PLLASHKPVLMVLATYLFFVKIAGPKIMRNRKPFDLRGLIKAYNIMQIVYNVIMCFFAVHFMLGP 84
            ||:.|..|.|.:...||.||.: |||.|::|:||.:|.::..||...::.|:.:  |...||   
Human    41 PLMQSPWPTLSISTLYLLFVWL-GPKWMKDREPFQMRLVLIIYNFGMVLLNLFI--FRELFM--- 99

  Fly    85 GDYN----FKC-----IKNLPPDHEYK----TWERWLTYSYFFNKLLDLLETVFFVLRKKDRQIS 136
            |.||    :.|     ..|:   ||.:    .|  |    ||.:|.::.|:||||:||||:.|:|
Human   100 GSYNAGYSYICQSVDYSNNV---HEVRIAAALW--W----YFVSKGVEYLDTVFFILRKKNNQVS 155

  Fly   137 FLHVFHHMYMLYFSFMYLYYYGY----GGHGFFMCFFNVVVHIMMYSYYYQSSLNRDSKGDLWWK 197
            ||||:||..|     ..|::.|.    ||..||....|..:|::|||||..::.....:..||||
Human   156 FLHVYHHCTM-----FTLWWIGIKWVAGGQAFFGAQLNSFIHVIMYSYYGLTAFGPWIQKYLWWK 215

  Fly   198 KYITIVQLIQFGIVLGH---SIYTLKQPDCPSARFSATCAGSISVVFIILFSNFYFHAYIRPKKR 259
            :|:|::|||||.:.:||   |:||    |||..::......:.::.||.||.|||...|..|||.
Human   216 RYLTMLQLIQFHVTIGHTALSLYT----DCPFPKWMHWALIAYAISFIFLFLNFYIRTYKEPKKP 276

  Fly   260 K 260
            |
Human   277 K 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9458NP_731419.1 ELO 20..261 CDD:279492 97/261 (37%)
ELOVL4NP_073563.1 ELO 41..278 CDD:279492 97/261 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..314 2/3 (67%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03204 310..314
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.