DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9458 and ELOVL1

DIOPT Version :9

Sequence 1:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001243328.1 Gene:ELOVL1 / 64834 HGNCID:14418 Length:279 Species:Homo sapiens


Alignment Length:264 Identity:97/264 - (36%)
Similarity:141/264 - (53%) Gaps:51/264 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PLLASHKPVLM--VLATYLFFVKIAGPKIMRNRKPFDLRGLIKAYNI------MQIVYNVIMCFF 76
            ||:.|  |:||  :|.||::||...||:||.|||||.|||.:..||.      :.|||..:|..:
Human    23 PLMGS--PLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLVALSLYIVYEFLMSGW 85

  Fly    77 AVHFMLGPGDYNFKCIKNLPPDH----EYKTWER--WLTYSYFFNKLLDLLETVFFVLRKKDRQI 135
            .       ..|.::|.   |.|:    |.....|  ||   :.|:|.::|::||.|:|||||.|:
Human    86 L-------STYTWRCD---PVDYSNSPEALRMVRVAWL---FLFSKFIELMDTVIFILRKKDGQV 137

  Fly   136 SFLHVFHHMYMLYFSFMYLYYYGYGGHGFFMCFFNVVVHIMMYSYYYQSSLNRDSKGDLWWKKYI 200
            :|||||||. :|.:|:.:......||.|.|....|..||::||.||..|:....::..|||||::
Human   138 TFLHVFHHS-VLPWSWWWGVKIAPGGMGSFHAMINSSVHVIMYLYYGLSAFGPVAQPYLWWKKHM 201

  Fly   201 TIVQLIQFGIVLGH-SIYTLKQPDCPSARFSATCAGSISV----------VFIILFSNFYFHAYI 254
            |.:|||||.:|..| |.|          .|.::|.....|          :|.:|||||::|:|.
Human   202 TAIQLIQFVLVSLHISQY----------YFMSSCNYQYPVIIHLIWMYGTIFFMLFSNFWYHSYT 256

  Fly   255 RPKK 258
            :.|:
Human   257 KGKR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9458NP_731419.1 ELO 20..261 CDD:279492 97/264 (37%)
ELOVL1NP_001243328.1 ELO 23..260 CDD:307345 96/262 (37%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03201 275..279
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.