DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9458 and elovl2

DIOPT Version :9

Sequence 1:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001016159.1 Gene:elovl2 / 548913 XenbaseID:XB-GENE-489753 Length:296 Species:Xenopus tropicalis


Alignment Length:253 Identity:86/253 - (33%)
Similarity:132/253 - (52%) Gaps:29/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LLASHKPVLMVLATYLFFVKI-AGPKIMRNRKPFDLRGLIKAYNIMQIVYNVIMCFFAVHFML-- 82
            :|.|:.|.|.:  |.|:|:.| .|.|.|:||..|.|||.:       ||||:::...:::.::  
 Frog    31 MLDSYLPTLFL--TLLYFLSIWLGTKYMQNRPAFSLRGHL-------IVYNLVVTLLSLYMLIEL 86

  Fly    83 ----GPGDYNFKCIKNLPPDHEYKTWERWLTYSYFFNKLLDLLETVFFVLRKKDRQISFLHVFHH 143
                ..|.||.:| :||....:.......:.:.|:|:|.::.::|:|||||||:.||:||||:||
 Frog    87 ILSTWEGGYNLQC-QNLDSAGKADVRVAKVLWWYYFSKAIEFMDTIFFVLRKKNSQITFLHVYHH 150

  Fly   144 MYMLYFSFMYLYYYGYGGHGFFMCFFNVVVHIMMYSYYYQSSLNRDSKGDLWWKKYITIVQLIQF 208
            ..|....:..|.:... |..||....|..:|::|||||..|.:....| .||||:|:|..||:||
 Frog   151 ASMFNIWWCVLNWIPC-GQSFFGPTLNSFIHVLMYSYYGLSVIPSMHK-YLWWKRYLTQAQLVQF 213

  Fly   209 GIVLGHSIYTLKQPDCPSARFSATC---AGSISVVFIILFSNFYFHAYIRPKKRKQKN 263
            .:.:.|::....:|    ..|...|   ..|.....:|||.|||...|   |||..|:
 Frog   214 LLTITHTLSAAVKP----CGFPFGCLMFQASYMATLVILFVNFYLKTY---KKRPSKS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9458NP_731419.1 ELO 20..261 CDD:279492 85/249 (34%)
elovl2NP_001016159.1 ELO 49..263 CDD:366492 78/230 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.