DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9458 and elovl5

DIOPT Version :9

Sequence 1:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001011248.1 Gene:elovl5 / 496694 XenbaseID:XB-GENE-952346 Length:295 Species:Xenopus tropicalis


Alignment Length:282 Identity:95/282 - (33%)
Similarity:138/282 - (48%) Gaps:50/282 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GDLVDFLGKSPPDP-VR-LPLLASHKPVLMVLATYLFFVKIAGPKIMRNRKPFDLRGLIKAYNIM 65
            |.:...||  |.|| || ..||.::.|.::..|.|||.| ..|||.|:||.|...||::..||:.
 Frog    10 GYIDHLLG--PKDPRVRGWLLLDNYVPTILFTALYLFIV-WRGPKYMQNRPPVSCRGILVVYNLG 71

  Fly    66 QIVYNVIMCFFAVHFMLGPGDYNFKC-IKNLPPDHEYK----TWERWLTYSYFFNKLLDLLETVF 125
            ..:.::.| |:.:...:..|.|||.| ..|...|.:.|    .|  |    |:|:||::.::|.|
 Frog    72 LTLLSLYM-FYELVTGVWEGGYNFFCQDTNSGGDADTKIVRVLW--W----YYFSKLIEFMDTFF 129

  Fly   126 FVLRKKDRQISFLHVFHHMYMLYFSFMYLYYYGYGGHGFFMCFFNVVVHIMMYSYYYQSSLNRDS 190
            |:|||.:.||:.|||:||..||.. :.::..:...||.:|....|..:|::|||||..|::.. .
 Frog   130 FILRKNNHQITVLHVYHHASMLNI-WWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSAIPA-M 192

  Fly   191 KGDLWWKKYITIVQLIQFGIVLGHSIYTLKQPDCPSARFSATCA---------------GSISVV 240
            :..||||||||..||.||       :.|:.|         .|||               ....:.
 Frog   193 RPYLWWKKYITQCQLTQF-------VLTMTQ---------TTCAMIWPCKFPMGWLYFQNCYMIS 241

  Fly   241 FIILFSNFYFHAYIRPKKRKQK 262
            .||||.|||...|.:....::|
 Frog   242 LIILFGNFYIKTYNKKTSSRRK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9458NP_731419.1 ELO 20..261 CDD:279492 86/260 (33%)
elovl5NP_001011248.1 ELO 28..261 CDD:366492 86/258 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..295
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.