DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9458 and zgc:92749

DIOPT Version :9

Sequence 1:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001002570.1 Gene:zgc:92749 / 436843 ZFINID:ZDB-GENE-040718-309 Length:266 Species:Danio rerio


Alignment Length:244 Identity:63/244 - (25%)
Similarity:115/244 - (47%) Gaps:34/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TYLFFVKIAGPKIMRNRKPFDLRGLIKAYNIMQIVYNVIMCFFAVHFMLGPGDYNFKCI-----K 93
            ||...: ..|...|::|:..|||..:       :::::.:..|::...|..|.|.|..:     :
Zfish    36 TYAVLI-FLGHMFMKDRQKLDLRAPL-------VLWSMSLAVFSIVGTLRTGWYMFNVVCSEGFR 92

  Fly    94 NLPPDHEY------KTWERWLTYSYFFNKLLDLLETVFFVLRKKDRQISFLHVFHHMYMLYFSFM 152
            ....|.::      |.|    .:::..:|..:|.:|||.||||  :::.|||.:||:.:|.:|: 
Zfish    93 QSVCDTDFYSAPVSKFW----AFAFAISKAPELGDTVFVVLRK--QRLIFLHWYHHITVLLYSW- 150

  Fly   153 YLYYYGYGGHGFFMCFFNVVVHIMMYSYYYQSSLN-RDSKGDLWWKKYITIVQLIQF--GIVLGH 214
            :.|.....|.|:||. .|..||..|||||...:.. |..:.   :...||::|:.|.  |:.:..
Zfish   151 FSYKDHVAGGGWFMS-MNFTVHAFMYSYYTAKAAGVRVPRA---FAMLITVLQISQMAAGLTVLG 211

  Fly   215 SIYTLK-QPDCPSARFSATCAGSISVVFIILFSNFYFHAYIRPKKRKQK 262
            .:|:.| :..|.|...:.....::...::.||..|::.:|||.....||
Zfish   212 LVYSWKHEQHCKSTDNNIIFGSAMYFSYLPLFCAFFYQSYIRRSDGGQK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9458NP_731419.1 ELO 20..261 CDD:279492 61/241 (25%)
zgc:92749NP_001002570.1 ELO 22..255 CDD:279492 61/237 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.