DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9458 and CG33110

DIOPT Version :9

Sequence 1:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster


Alignment Length:252 Identity:86/252 - (34%)
Similarity:133/252 - (52%) Gaps:10/252 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PDPVRLPLLASHKPVLMVLATYLFFVKIAGPKIMRNRKPFDLRGLIKAYNIMQIVYNVIMCFFAV 78
            |...|.||:........::|.||.:|.:.||..||:||||.||..:..||..|:..:..|  |..
  Fly    55 PRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRRTLVVYNAFQVALSGYM--FYE 117

  Fly    79 HFMLG-PGDYNFKCIKNLPPDH-EYKTWERWLT--YSYFFNKLLDLLETVFFVLRKKDRQISFLH 139
            |.|.| ...||.||   .|.|: :..:.:|.|.  |.|:.:||.:..:|:|||||||..||::||
  Fly   118 HLMAGWLNYYNLKC---QPVDYSDSPSSKRMLNLCYLYYLSKLTEFADTMFFVLRKKSSQITWLH 179

  Fly   140 VFHHMYMLYFSFMYLYYYGYGGHGFFMCFFNVVVHIMMYSYYYQSSLNRDSKGDLWWKKYITIVQ 204
            |:||......:::.:.:.. ||:..|....|..||:.||.||..:::..:....||||||:|.:|
  Fly   180 VYHHSVTPLETWVLVKFLA-GGNATFPNLLNNFVHVCMYFYYMMAAMGPEYAKFLWWKKYMTELQ 243

  Fly   205 LIQFGIVLGHSIYTLKQPDCPSARFSATCAGSISVVFIILFSNFYFHAYIRPKKRKQ 261
            :.||.:.:.|::..|....|..::|.:......:.:|..||.|||..:|.:.|..:|
  Fly   244 IAQFVLCIFHTLRALFSNQCQFSKFISALLLLNASIFFCLFMNFYMQSYRKTKAAQQ 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9458NP_731419.1 ELO 20..261 CDD:279492 83/244 (34%)
CG33110NP_788716.1 ELO 61..294 CDD:279492 82/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449584
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.