DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9458 and elovl1b

DIOPT Version :9

Sequence 1:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001315523.1 Gene:elovl1b / 406725 ZFINID:ZDB-GENE-040426-2755 Length:320 Species:Danio rerio


Alignment Length:274 Identity:101/274 - (36%)
Similarity:138/274 - (50%) Gaps:50/274 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DPVRL---PLLASHKPVLMVLATYLFFVKIAGPKIMRNRKPFDLRGLIKAYNI------MQIVYN 70
            || ||   ||:.|...:..:|..|||||..||||.|.|||||.|:..:..||:      ..|||.
Zfish    21 DP-RLKDYPLMESPFSMTAILLAYLFFVLYAGPKFMANRKPFQLKEAMIIYNLSLVGLSAYIVYE 84

  Fly    71 VIMCFFAVHF--MLGPGDYNFKCIKNLPPDHEYKTWERWLTYSYFFNKLLDLLETVFFVLRKKDR 133
            .:|..:|..:  ...|.||:     |.|....... ..||   :.|:|.::|::|||||||||..
Zfish    85 FLMSGWATGYTWRCDPCDYS-----NSPQGLRMAR-VAWL---FLFSKFIELMDTVFFVLRKKHS 140

  Fly   134 QISFLHVFHHMYMLYFSFMYLYYYGY----GGHGFFMCFFNVVVHIMMYSYYYQSSLNRDSKGDL 194
            ||:|||:|||.:|     .:.:::|.    ||.|.|....|..||::||.||..|:.....:..|
Zfish   141 QITFLHIFHHSFM-----PWTWWWGVSIVPGGMGSFHAMVNSCVHVIMYFYYGLSAAGPRFQKFL 200

  Fly   195 WWKKYITIVQLIQFGIVLGHSIYTLKQPDCPSARFSATCAGSISVV----------FIILFSNFY 249
            |||||:|.:||.||.:|..|         .....|..:|...:.|:          |.:|||||:
Zfish   201 WWKKYMTAIQLTQFVLVSLH---------VSQWYFMESCDFQVPVIIHLIWLYGTFFFVLFSNFW 256

  Fly   250 FHAYIRPKKRKQKN 263
            :.|||: .||..||
Zfish   257 YQAYIK-GKRLPKN 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9458NP_731419.1 ELO 20..261 CDD:279492 95/262 (36%)
elovl1bNP_001315523.1 ELO 28..268 CDD:279492 95/263 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.