DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9458 and CG31522

DIOPT Version :9

Sequence 1:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001262254.1 Gene:CG31522 / 40567 FlyBaseID:FBgn0051522 Length:392 Species:Drosophila melanogaster


Alignment Length:270 Identity:89/270 - (32%)
Similarity:140/270 - (51%) Gaps:47/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PLLASHKPVLMVLATYLFFVKIAGPKIMRNRKPFDLRGLIKAYNIMQIVYNVIMCFFAVHFMLGP 84
            |:::|..|.|.|..||::.||:.||::|.||||.:|:..:..||.:|:|::..:.:   ..::|.
  Fly    27 PMMSSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQNTLVMYNAIQVVFSAWLFY---ECLMGG 88

  Fly    85 --GDYNFKCIKNLPPDHEYKTWER------WLT-----------YS--------------YFFNK 116
              |.|:|:|   .|.|:......|      |||           ||              |:|:|
  Fly    89 WWGSYSFRC---QPVDYTDSPTSRRIGISGWLTGHYSFRCQPVDYSNNPRTLRMVHACWWYYFSK 150

  Fly   117 LLDLLETVFFVLRKKDRQISFLHVFHHMYM---LYFSFMYLYYYGYGGHGFFMCFFNVVVHIMMY 178
            ..:.::|:|||||||..|::.|||.||..|   ::|...:.    .|||..|....|..|||:||
  Fly   151 FTEFMDTIFFVLRKKSSQVTTLHVIHHGCMPMSVWFGVKFT----PGGHSTFFGLLNTFVHIVMY 211

  Fly   179 SYYYQSSLNRDSKGDLWWKKYITIVQLIQFGIVLGHSIYTLKQPDCPSARFSATCAGSISVVFII 243
            :||..|::....:..||||||:|.:|::||.:::.|: :.|...||...:......|..:|:|..
  Fly   212 TYYMFSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHA-FQLLFIDCNYPKAFVWWIGMHAVMFFF 275

  Fly   244 LFSNFYFHAY 253
            ||:.||..||
  Fly   276 LFNEFYKAAY 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9458NP_731419.1 ELO 20..261 CDD:279492 89/270 (33%)
CG31522NP_001262254.1 ELO 27..293 CDD:279492 89/270 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449628
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.