DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9458 and elovl5

DIOPT Version :9

Sequence 1:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_956747.1 Gene:elovl5 / 393425 ZFINID:ZDB-GENE-040407-2 Length:291 Species:Danio rerio


Alignment Length:254 Identity:84/254 - (33%)
Similarity:128/254 - (50%) Gaps:39/254 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LLASHKPVLMVLATYLFFVKIAGPKIMRNRKPFDLRGLIKAYNIMQIVYNVIMCFFAVHFMLGPG 85
            ||..:.|..:....||..|.: |||.|:||:.:..|.|:..||:...:.::.| |:.:...:..|
Zfish    28 LLDDYIPTFIFTVMYLLIVWM-GPKYMKNRQAYSCRALLVPYNLCLTLLSLYM-FYELVMSVYQG 90

  Fly    86 DYNFKCIKNLPPDHEYKTWERWLTYSYFFNKLLDLLETVFFVLRKKDRQISFLHVFHHMYMLYFS 150
            .|||.| :|.....:.......:.:.|:|:||::.::|.||:|||.:.||:||||:||..||.. 
Zfish    91 GYNFFC-QNTHSGGDADNRMMNVLWWYYFSKLIEFMDTFFFILRKNNHQITFLHVYHHATMLNI- 153

  Fly   151 FMYLYYYGYGGHGFFMCFFNVVVHIMMYSYYYQSSLNRDSKGDLWWKKYITIVQLIQFGIVLGHS 215
            :.::..:...||.:|...||..:|::|||||..|::.. .:..||||||||..||:||.:.:   
Zfish   154 WWFVMNWVPCGHSYFGATFNSFIHVLMYSYYGLSAVPA-LRPYLWWKKYITQGQLVQFVLTM--- 214

  Fly   216 IYTLKQPDCPSARFSATCAG---------------SISVVFIILFSNFYFHAYIRPKKR 259
                         |..:||.               |..|..|:||||||...|   |||
Zfish   215 -------------FQTSCAVVWPCGFPMGWLYFQISYMVTLILLFSNFYIQTY---KKR 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9458NP_731419.1 ELO 20..261 CDD:279492 84/254 (33%)
elovl5NP_956747.1 ELO 27..262 CDD:279492 84/254 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.