DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9458 and Elovl7

DIOPT Version :9

Sequence 1:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001178773.1 Gene:Elovl7 / 361895 RGDID:1310560 Length:281 Species:Rattus norvegicus


Alignment Length:263 Identity:91/263 - (34%)
Similarity:140/263 - (53%) Gaps:37/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LLASHKPVLMVLATYLFFVKIAGPKIMRNRKPFDLRGLIKAYNIMQIVYNVIMCFFAVHFMLGPG 85
            |::|..|..::|..|::||...|||:|.|||||:|:..:..||...::::|.||:..|....|.|
  Rat    30 LMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGTG 94

  Fly    86 DYNFKCIKNLPPDHEYKTWER--------WLTYSYFFNKLLDLLETVFFVLRKKDRQISFLHVFH 142
             |:|:|     ...:|....|        ||   |:|:|.::|.:|:|||||||:.|::||||||
  Rat    95 -YSFRC-----DIVDYSQSPRAMRMVHTCWL---YYFSKFIELFDTIFFVLRKKNSQVTFLHVFH 150

  Fly   143 HMYMLYFSFMYLYYYGY----GGHGFFMCFFNVVVHIMMYSYYYQSSLNRDSKGDLWWKKYITIV 203
            |..|     .:.:::|.    ||.|.|....|..||::||.||...::....:..|||||::|.:
  Rat   151 HTIM-----PWTWWFGVKFAAGGLGTFHALLNTAVHVVMYFYYGLCAMGPAYQKYLWWKKHLTSL 210

  Fly   204 QLIQFGIVLGHSIYTLKQPDC----PSARFSATCAGSISVVFIILFSNFYFHAYIR----PKKRK 260
            ||:||.:|..|........||    |...:.....|.|   |::||.:|::.||.:    ||..:
  Rat   211 QLVQFVLVTVHIGQIFFMEDCNYQYPVFLYIIMSYGCI---FLLLFLHFWYRAYTKGQRLPKTME 272

  Fly   261 QKN 263
            ..|
  Rat   273 NGN 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9458NP_731419.1 ELO 20..261 CDD:279492 90/259 (35%)
Elovl7NP_001178773.1 ELO 30..269 CDD:395916 88/255 (35%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03207 277..281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.