DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9458 and elovl7b

DIOPT Version :9

Sequence 1:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_956072.1 Gene:elovl7b / 327274 ZFINID:ZDB-GENE-030131-5485 Length:282 Species:Danio rerio


Alignment Length:269 Identity:96/269 - (35%)
Similarity:151/269 - (56%) Gaps:19/269 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DFLGKSPPDPVRLPLLASHKPVLMVLATYLFFVKIAGPKIMRNRKPFDLRGLIKAYNIMQIVYNV 71
            ::|.::.|......|:.|..|...::|.|:|||...||::|.|||||.|:..:..||:..:::::
Zfish    16 EWLKEADPRTGNWLLMGSPFPQTFIIAAYVFFVTTLGPRLMENRKPFQLKNTMIIYNLSIVLFSL 80

  Fly    72 IMCFFAVHFMLG--PGDYNFKC---IKNLPPDHEYKTWERWLTYSYFFNKLLDLLETVFFVLRKK 131
            .|.:   .|::.  ...|.::|   ..:..|......|..||   |:|:|.:::|:|||||||||
Zfish    81 YMIY---EFLMSGWANGYTYRCDLVDYSSSPQALRMAWTCWL---YYFSKFIEMLDTVFFVLRKK 139

  Fly   132 DRQISFLHVFHHMYMLYFSFMYLYYYGYGGHGFFMCFFNVVVHIMMYSYYYQSSLNRDSKGDLWW 196
            ..|:|||||:||..| .|::.:...:..||.|.|....|.:||::|||||..|:|....:..|||
Zfish   140 SSQVSFLHVYHHSIM-PFTWWFGVRFAPGGLGTFHALLNCIVHVIMYSYYLLSALGPKYQKYLWW 203

  Fly   197 KKYITIVQLIQFGIVLGHSIYTLKQPDCPSARFSA--TCAGSISVVFIILFSNFYFHAYIR---- 255
            |||:|.:||:||.:|..|........||| .:|..  ...|...::|::||.:||:|||.|    
Zfish   204 KKYMTTIQLVQFVLVTAHIGQFFFMQDCP-YQFPVFLYIIGLYGLIFLLLFLHFYYHAYTRGKRL 267

  Fly   256 PKKRKQKNI 264
            ||..:.:|:
Zfish   268 PKVLQNRNL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9458NP_731419.1 ELO 20..261 CDD:279492 93/251 (37%)
elovl7bNP_956072.1 ELO 30..228 CDD:279492 77/204 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.