DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9458 and Elovl4

DIOPT Version :9

Sequence 1:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001178725.1 Gene:Elovl4 / 315851 RGDID:1305630 Length:314 Species:Rattus norvegicus


Alignment Length:263 Identity:94/263 - (35%)
Similarity:138/263 - (52%) Gaps:48/263 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PLLASHKPVLMVLATYLFFVKIAGPKIMRNRKPFDLRGLIKAYNIMQIVYNVIMCFFAVHFMLGP 84
            ||:.|..|.|.:...||.||.: |||.|::|:||.:|.::..||...::.|:.:  |...||   
  Rat    41 PLMQSPWPTLSISTLYLLFVWL-GPKWMKDREPFQMRLVLIIYNFGMVLLNLFI--FRELFM--- 99

  Fly    85 GDYN----FKCIKNLPPDHEYKT-----------WERWLTYSYFFNKLLDLLETVFFVLRKKDRQ 134
            |.||    :.|     ...:|..           |  |    ||.:|.::.|:||||:||||:.|
  Rat   100 GSYNAGYSYIC-----QSVDYSNDVNEVRIAAALW--W----YFVSKGVEYLDTVFFILRKKNNQ 153

  Fly   135 ISFLHVFHHMYMLYFSFMYLYYYGY----GGHGFFMCFFNVVVHIMMYSYYYQSSLNRDSKGDLW 195
            :|||||:||..|     ..|::.|.    ||..||....|..:|::|||||..::.....:..||
  Rat   154 VSFLHVYHHCTM-----FTLWWIGIKWVAGGQAFFGAQMNSFIHVIMYSYYGLTAFGPWIQKYLW 213

  Fly   196 WKKYITIVQLIQFGIVLGH---SIYTLKQPDCPSARFSATCAGSISVVFIILFSNFYFHAYIRPK 257
            ||:|:|::||:||.:.:||   |:||    |||..::......:.::.||.||.|||...|..||
  Rat   214 WKRYLTMLQLVQFHVTIGHTALSLYT----DCPFPKWMHWALIAYAISFIFLFLNFYTRTYNEPK 274

  Fly   258 KRK 260
            |.|
  Rat   275 KSK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9458NP_731419.1 ELO 20..261 CDD:279492 94/263 (36%)
Elovl4NP_001178725.1 ELO 41..278 CDD:395916 94/263 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.