DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9458 and Elovl3

DIOPT Version :9

Sequence 1:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001101072.1 Gene:Elovl3 / 309449 RGDID:1307263 Length:271 Species:Rattus norvegicus


Alignment Length:246 Identity:66/246 - (26%)
Similarity:113/246 - (45%) Gaps:34/246 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VLATYLFFVKIAGPKIMRNRKPFDLRGLIKAYNIMQIVYNVI----MCFFAVHFMLGPGDYNFKC 91
            ::..||..: |.|...|:.||.|.|:..:..::....:::::    |..|....:...|.....|
  Rat    41 IVLVYLLLI-IFGQNYMKTRKGFSLQRPLILWSFCLAIFSILGTLRMWKFMGTVLFTMGLKQTVC 104

  Fly    92 IKNLPPDHEYKTWERWLTYSYFFNKLLDLLETVFFVLRKKDRQISFLHVFHHMYMLYFSFMYLYY 156
            ..:...|...|.|. |:   :..:|:::|.:|.|.:|||  |.:.|:|.:||..:|.|:     .
  Rat   105 FTDYTNDAIVKFWS-WV---FLLSKVVELGDTAFIILRK--RPLIFVHWYHHSTVLLFT-----S 158

  Fly   157 YGYGGH----GFFMCFFNVVVHIMMYSYYYQSSLNRDSKGDLWWKKYITIVQLIQ--FGIVLGHS 215
            :||...    |:||. .|:.||.:||:||...:........|  ...||.:|::|  .|.:.|..
  Rat   159 FGYKNKVPSGGWFMT-MNLGVHSVMYTYYTMKAAKVKHPNIL--PMVITSLQILQMVLGTIFGIL 220

  Fly   216 IYTLKQP-DC--PSARF--SATCAGSISVVFIILFSNFYFHAYIRPKKRKQ 261
            .|..:|. .|  .|..|  |....|:    :.|||:.|:..||:|||::.:
  Rat   221 NYIWRQERGCYTTSEHFFWSFVLYGT----YFILFAQFFHRAYLRPKRKAE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9458NP_731419.1 ELO 20..261 CDD:279492 66/244 (27%)
Elovl3NP_001101072.1 ELO 30..266 CDD:279492 66/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.