DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9458 and CG30008

DIOPT Version :9

Sequence 1:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_724853.1 Gene:CG30008 / 246388 FlyBaseID:FBgn0050008 Length:266 Species:Drosophila melanogaster


Alignment Length:244 Identity:79/244 - (32%)
Similarity:124/244 - (50%) Gaps:19/244 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VLMVLATYLFFVKIAGPKIMRNRKPFDLRGLIKAYNIMQIVYNVIMCFFAVHFMLGPGD---YNF 89
            ::.||..||:||..|||..|..|||::|:.||..:|.:|    |:.|.:|:..:|...|   |.|
  Fly    25 MITVLVLYLYFVTKAGPHFMEWRKPYELKRLILLHNFIQ----VVSCIYAIKEVLYITDNTIYIF 85

  Fly    90 -KCIKNLPPDHEYKTWERWLTYSYFFNKLLDLLETVFFVLRKKDRQISFLHVFHHMYMLYFSFMY 153
             || :::....|.......|.|..|:.|:.:|:|||.||||||..|:|.||:|||...:...:..
  Fly    86 WKC-RDIGSSPELVRRYYNLAYFLFWLKISELIETVIFVLRKKQNQVSKLHIFHHFSTVTLVYAL 149

  Fly   154 LYYYGYGGHGFFMCFFNVVVHIMMYSYYYQSSLNRDSKGDLWW--KKYITIVQLIQFGIVLGHSI 216
            :.:...|...:|..|.|.:||::|||||:.:::...:......  ||.||::|:.||.::|....
  Fly   150 INFNENGSAAYFCVFLNSIVHVIMYSYYFVAAVADKTLVQALTPVKKCITVIQMTQFVLILTQVA 214

  Fly   217 YTL---KQPDCPSARFSATCAGSISVVFIILFSNFYFHAYIRPKKRKQK 262
            :.|   ..|......|:....|     ....|.:||..||...::||.:
  Fly   215 FQLVLCGMPPLVLLYFTTVILG-----MFYGFYDFYNSAYQASQRRKSQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9458NP_731419.1 ELO 20..261 CDD:279492 78/241 (32%)
CG30008NP_724853.1 ELO 20..257 CDD:279492 78/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449570
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
98.900

Return to query results.
Submit another query.