DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9458 and Elovl5

DIOPT Version :9

Sequence 1:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_599209.1 Gene:Elovl5 / 171400 RGDID:620583 Length:299 Species:Rattus norvegicus


Alignment Length:268 Identity:86/268 - (32%)
Similarity:132/268 - (49%) Gaps:58/268 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LLASHKPVLMVLATYLFFVKIAGPKIMRNRKPFDLRGLIKAYNIMQIVYNVIMCFFAVHFMLGPG 85
            ||.::.|..:..|.||..|.: |||.|:||:||..||::..||:...:.::.| |:.:...:..|
  Rat    28 LLDNYIPTFVCSAIYLLIVWL-GPKYMKNRQPFSCRGILVVYNLGLTLLSLYM-FYELVTGVWEG 90

  Fly    86 DYNFKC-------------IKNLPPDHEYKTWERWLTYSYFFNKLLDLLETVFFVLRKKDRQISF 137
            .|||.|             |:.|        |  |    |:|:||::.::|.||:|||.:.||:.
  Rat    91 KYNFFCQGTRSAGESDMKVIRVL--------W--W----YYFSKLIEFMDTFFFILRKNNHQITV 141

  Fly   138 LHVFHHMYMLYFSFMYLYYYGYGGHGFFMCFFNVVVHIMMYSYYYQSSLNRDSKGDLWWKKYITI 202
            |||:||..||.. :.::..:...||.:|....|..:|::|||||..||: ...:..||||||||.
  Rat   142 LHVYHHATMLNI-WWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSV-PSMRPYLWWKKYITQ 204

  Fly   203 VQLIQFGIVLGHSIYTLKQPDC----PSARFSATCAGSIS---------VVFIILFSNFYFHAYI 254
            .||:||       :.|:.|..|    |       |:..:.         :..|.||:|||...|.
  Rat   205 GQLVQF-------VLTIIQTSCGVIWP-------CSFPLGWLYFQIGYMISLIALFTNFYIQTYN 255

  Fly   255 RPKKRKQK 262
            :....::|
  Rat   256 KKGASRRK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9458NP_731419.1 ELO 20..261 CDD:279492 85/265 (32%)
Elovl5NP_599209.1 ELO 27..261 CDD:395916 85/264 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.