DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9458 and Elovl6

DIOPT Version :9

Sequence 1:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_569717.1 Gene:Elovl6 / 170439 MGIID:2156528 Length:267 Species:Mus musculus


Alignment Length:254 Identity:69/254 - (27%)
Similarity:123/254 - (48%) Gaps:36/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KPVLMVLATYLFFVKIAGPKIMRNRKPFDLRGLIKAYNIMQIVYNVIMCFFAVHFMLGPGDYNF- 89
            |...:..|.|..|: ..|..:|..|..|:||..:       :::::.:..|::...|..|.|.. 
Mouse    31 KKSFLFSALYAAFI-FGGRHLMNKRAKFELRKPL-------VLWSLTLAVFSIFGALRTGAYMLY 87

  Fly    90 ----KCIKNLPPDHEY------KTWERWLTYSYFFNKLLDLLETVFFVLRKKDRQISFLHVFHHM 144
                |.:|....|..:      |.|    .|::..:|..:|.:|:|.:|||  :::.|||.:||:
Mouse    88 ILMTKGLKQSVCDQSFYNGPVSKFW----AYAFVLSKAPELGDTIFIILRK--QKLIFLHWYHHI 146

  Fly   145 YMLYFSFMYLYYYGYGGHGFFMCFFNVVVHIMMYSYY-YQSSLNRDSKGDLWWKKYITIVQLIQ- 207
            .:|.:|: |.|.....|.|:||. .|..||.:||||| .:::..|.|:.   :..:||:.|:.| 
Mouse   147 TVLLYSW-YSYKDMVAGGGWFMT-MNYGVHAVMYSYYALRAAGFRVSRK---FAMFITLSQITQM 206

  Fly   208 -FGIVLGHSIYTLKQPD---CPSARFSATCAGSISVVFIILFSNFYFHAYIRPKKRKQK 262
             .|.|:.:.::...|.|   |.|...:...:..:.:.:::||.:|:|.|||...|:..|
Mouse   207 LMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKVKKATK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9458NP_731419.1 ELO 20..261 CDD:279492 68/251 (27%)
Elovl6NP_569717.1 ELO 25..264 CDD:395916 68/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1820
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.660

Return to query results.
Submit another query.