DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9458 and Elovl3

DIOPT Version :9

Sequence 1:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_031729.1 Gene:Elovl3 / 12686 MGIID:1195976 Length:271 Species:Mus musculus


Alignment Length:239 Identity:61/239 - (25%)
Similarity:108/239 - (45%) Gaps:26/239 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 MVLATYLFFVKIAGPKIMRNRKPFDLRGLIKAYNIMQIVYNVI----MCFFAVHFMLGPGDYNFK 90
            :::..||..: :.|...||.||.|.|:..:..::....:::::    |..|....|...|.....
Mouse    40 LIVVVYLLLI-VVGQTYMRTRKSFSLQRPLILWSFFLAIFSILGTLRMWKFMATVMFTVGLKQTV 103

  Fly    91 CIKNLPPDHEYKTWERWLTYSYFFNKLLDLLETVFFVLRKKDRQISFLHVFHHMYMLYFSFMYLY 155
            |......|...:.|    ::.:..:|:::|.:|.|.:|||  |.:.|:|.:||..:|.|:     
Mouse   104 CFAIYTDDAVVRFW----SFLFLLSKVVELGDTAFIILRK--RPLIFVHWYHHSTVLLFT----- 157

  Fly   156 YYGYGGH----GFFMCFFNVVVHIMMYSYYYQSSLNRDSKGDLWWKKYITIVQLIQ--FGIVLGH 214
            .:||...    |:||. .|..||.:||:||...:........|  ...||.:|::|  .|.:.|.
Mouse   158 SFGYKNKVPSGGWFMT-MNFGVHSVMYTYYTMKAAKLKHPNLL--PMVITSLQILQMVLGTIFGI 219

  Fly   215 SIYTLKQ-PDCPSARFSATCAGSISVVFIILFSNFYFHAYIRPK 257
            ..|..:| ..|.:.......:..:...:.|||::|:..||:|||
Mouse   220 LNYIWRQEKGCHTTTEHFFWSFMLYGTYFILFAHFFHRAYLRPK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9458NP_731419.1 ELO 20..261 CDD:279492 61/239 (26%)
Elovl3NP_031729.1 ELO 52..267 CDD:366492 59/226 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.