DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9458 and elovl3

DIOPT Version :9

Sequence 1:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_002935809.1 Gene:elovl3 / 100497108 XenbaseID:XB-GENE-977704 Length:270 Species:Xenopus tropicalis


Alignment Length:251 Identity:65/251 - (25%)
Similarity:118/251 - (47%) Gaps:46/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 MVLATYLFFVKIAGPKIMRNRKPFDLRGLIKAYNIMQIVYNVIMC----FFAVHFMLGPGDYNFK 90
            ::.|..:|    .|.::|:.|:.|:||..:..::....|:::|..    :|..:.::..|.....
 Frog    44 LLYAALIF----GGQRMMKERRRFELRRPLVLWSFTLAVFSIIGAVRTGWFMGNILITNGFKQSV 104

  Fly    91 CIKNLPPDHEYKTWERWLTYSYFFNKLLDLLETVFFVLRKKDRQISFLHVFHHMYMLYFSFMYLY 155
            |.:........|.|    .|::..:|:.:|.:|:|.||||  :::.|||.:||:.:|.::: |.|
 Frog   105 CDRAFYSGPVSKFW----AYAFVLSKVPELGDTLFIVLRK--QKLIFLHWYHHITVLLYTW-YTY 162

  Fly   156 YYGYGGHGFFMCFFNVVVHIMMYSYYYQSS----LNRDSKGDLWWKKYITIVQLIQ--FGIVLGH 214
            .....|.|:||. .|..||..|||||...:    :.|..      ..:||..|::|  .|||:..
 Frog   163 KDTVAGGGWFMT-MNYTVHAFMYSYYTLRAAGIRVPRPC------AMFITFTQILQMVMGIVVNA 220

  Fly   215 SIYTLKQPDCPSARFSATCAGSISVVF---------IILFSNFYFHAYIR-PKKRK 260
            .:|:.:|        ..:|..:...:|         .|||.:|::.||:: |.|.|
 Frog   221 LVYSWRQ--------DGSCLSTTENIFWSCLMYFSYFILFCSFFYKAYLKYPIKNK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9458NP_731419.1 ELO 20..261 CDD:279492 65/251 (26%)
elovl3XP_002935809.1 ELO 31..262 CDD:366492 62/243 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.