DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9458 and elovl6l

DIOPT Version :9

Sequence 1:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_958908.1 Gene:elovl6l / 100150288 ZFINID:ZDB-GENE-031110-3 Length:268 Species:Danio rerio


Alignment Length:238 Identity:64/238 - (26%)
Similarity:118/238 - (49%) Gaps:28/238 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ATYLFFVKIAGPKIMRNRKPFDLRGLIKAYNIMQIVYNVI-----MCFFAVHFMLGPGDYNFKCI 92
            |.|:..| ..|...|::|:..|||.::..:::...::::|     .||. ::.:...|.....|.
Zfish    40 AVYVVLV-FGGQHFMKDRQRLDLRKVLMMWSLSLAIFSIIGAVRTGCFM-LYILSTSGFKQSVCD 102

  Fly    93 KNLPPDHEYKTWERWLTYSYFFNKLLDLLETVFFVLRKKDRQISFLHVFHHMYMLYFSFMYLYYY 157
            ::.    .|....::...::..:|..:|.:|:|.||||  :::.|||.:||:.:|.:|: |.|..
Zfish   103 QSF----YYGPISKFWACAFVLSKAPELGDTMFIVLRK--QRLIFLHWYHHITVLVYSW-YSYKD 160

  Fly   158 GYGGHGFFMCFFNVVVHIMMYSYYYQSSLNRDSKGDLWWKK----YITIVQLIQFGIVLGHS--I 216
            ...|.|:||. .|..||.:|||||...:      ..|...|    .||..|:.|..:.|..|  :
Zfish   161 QVAGGGWFMT-MNYTVHALMYSYYAARA------AGLRVPKPCAILITSSQIAQMAMDLAVSALV 218

  Fly   217 YT-LKQPDCPSARFSATCAGSISVVFIILFSNFYFHAYIRPKK 258
            |. ::..||||...:...|..:.:.:::|||:|::.:|::..|
Zfish   219 YRWMQDGDCPSYLDNIVWASLMYLSYLLLFSSFFYQSYMKSSK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9458NP_731419.1 ELO 20..261 CDD:279492 64/238 (27%)
elovl6lNP_958908.1 ELO 27..264 CDD:279492 64/238 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.