DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9459 and HOS3-1

DIOPT Version :10

Sequence 1:NP_649958.2 Gene:CG9459 / 41213 FlyBaseID:FBgn0037764 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001329164.1 Gene:HOS3-1 / 829836 AraportID:AT4G36830 Length:308 Species:Arabidopsis thaliana


Alignment Length:76 Identity:15/76 - (19%)
Similarity:38/76 - (50%) Gaps:5/76 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 WLSYSYFFNKLMDLLETVFFIFRKKYRQISFLHVFHHVYMVYIGFLYMYYYGYGGHGFFLITFNV 171
            | ||.::..:.:.:..|:|.:.|.  |:::...:|.:..|.:..||::.:  ...:....|....
plant   132 W-SYVFYLTRFLHMFRTIFAVLRS--RRLAVSQLFCNSVMAFTSFLWLEF--SQSYQILAILSTT 191

  Fly   172 VVHTMMYTYYY 182
            :|::::|.|.:
plant   192 LVYSVVYGYRF 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9459NP_649958.2 ELO 20..261 CDD:460083 15/76 (20%)
HOS3-1NP_001329164.1 ELO 30..258 CDD:470741 15/76 (20%)

Return to query results.
Submit another query.