DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9459 and sit

DIOPT Version :9

Sequence 1:NP_649958.2 Gene:CG9459 / 41213 FlyBaseID:FBgn0037764 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_651063.1 Gene:sit / 42658 FlyBaseID:FBgn0038986 Length:295 Species:Drosophila melanogaster


Alignment Length:276 Identity:98/276 - (35%)
Similarity:145/276 - (52%) Gaps:46/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DFLNRSPPDP-------VRLPLTSSHWPVLTILGIYLVFIKIVGPWFMQNQKPYNLDRAIKIYNI 64
            :||.....||       ::.||     |:|.||..||.|:...||.||:::||:.|:|.:.:||.
  Fly    13 NFLFTDLADPRTNDWFLIKSPL-----PLLGILAFYLFFVLSWGPKFMKDRKPFKLERTLLVYNF 72

  Fly    65 VQIAYNVILLIFSVHFMLGPG-----NYNFSCISNLPLDHEYKNWERW--------LSYSYFFNK 116
            .|:|.:|        :|:..|     .|::.|   .|:|     |.|.        :.|.|:..|
  Fly    73 FQVALSV--------WMVYEGVVIWQYYSWRC---QPVD-----WSRTPKAYREARVVYVYYLAK 121

  Fly   117 LMDLLETVFFIFRKKYRQISFLHVFHHVYMVYIGFLYMYYYGYGGHGFFLITFNVVVHTMMYTYY 181
            :.:||:|:||:.||..||::||||:||..|..|.:....||. ||||.|:...|..||.:||:||
  Fly   122 ITELLDTIFFVLRKNDRQVTFLHVYHHTVMPMISWGTSKYYP-GGHGTFIGWINSFVHIIMYSYY 185

  Fly   182 YQSSLNRNSGGDLWWKKYITVVQLVQFVIIFSHSVYILRQTDCQTSRLSATWGSLISVVFIILFS 246
            :.|:........||||||||.:|::||...|.|...:| .|||...|.|..:....:|.|..||:
  Fly   186 FLSAFGPQMQKYLWWKKYITNLQMIQFCCAFIHQTQLL-YTDCGYPRWSVCFTLPNAVFFYFLFN 249

  Fly   247 NFYVRTYILPKKTKSA 262
            :||.::|   ||.::|
  Fly   250 DFYQKSY---KKKQAA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9459NP_649958.2 ELO 20..261 CDD:279492 93/253 (37%)
sitNP_651063.1 ELO 28..252 CDD:279492 88/246 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449599
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.