DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9459 and CG31523

DIOPT Version :9

Sequence 1:NP_649958.2 Gene:CG9459 / 41213 FlyBaseID:FBgn0037764 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster


Alignment Length:276 Identity:88/276 - (31%)
Similarity:134/276 - (48%) Gaps:32/276 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FAHMLDFLNRSPPDPVRLPLTSSHWPVLTILGIYLVFIKIVGPWFMQNQKPYNLDRAIKIYNIVQ 66
            :..::|  |:|.|......|.||..|.|.:...|..|.|.:||..|..:||..|...:.:||.:|
  Fly    12 YRDLMD--NKSDPRVNDFFLLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQ 74

  Fly    67 IAYNVILLIFSVHFMLG-PGNYNFSCISNLPLDHEYKN---------WERWLSYSYFFNKLMDLL 121
            ..::.  .||..:.|.| .|:|:..|   .|:|:....         |  |    |:.:|..:..
  Fly    75 TIFSA--WIFYEYLMSGWWGHYSLKC---QPVDYSTTGLAMRMVNICW--W----YYISKFTEFF 128

  Fly   122 ETVFFIFRKKYRQISFLHVFHH---VYMVYIGFLYMYYYGYGGHGFFLITFNVVVHTMMYTYYYQ 183
            :|:|||.|||...:|.|||.||   .:.|::|.    .:..|||..|....|..||.:||.||..
  Fly   129 DTLFFILRKKNEHVSTLHVIHHGCMPFSVWMGL----KFAPGGHSTFFALLNSFVHIVMYFYYMI 189

  Fly   184 SSLNRNSGGDLWWKKYITVVQLVQFVIIFSHSVYILRQTDCQTSRLSATWGSLISVVFIILFSNF 248
            :::.......:|||||:|..|:||||.||:|...:|.: :|...:....|..|..|:|:.|||:|
  Fly   190 AAMGPKYQKYIWWKKYLTTFQMVQFVAIFTHQFQLLFR-ECDYPKGFMVWIGLHGVMFLFLFSDF 253

  Fly   249 YVRTYI-LPKKTKSAV 263
            |...|: ..::.:.||
  Fly   254 YKAKYLNAARRRRQAV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9459NP_649958.2 ELO 20..261 CDD:279492 82/254 (32%)
CG31523NP_001262255.1 ELO 28..265 CDD:279492 82/252 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449645
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.