DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and Elovl4

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_683743.2 Gene:Elovl4 / 83603 MGIID:1933331 Length:312 Species:Mus musculus


Alignment Length:267 Identity:99/267 - (37%)
Similarity:144/267 - (53%) Gaps:28/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VFDKPFADPVQLPLAGSIRTSVIIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFNSV 68
            :.||..||   .||..|...::.|.|:|||||. ||.|.|...|..|:|.||..||.|.||.|..
Mouse    32 IADKRVAD---WPLMQSPWPTISISTLYLLFVW-LGPKWMKDREPFQMRLVLIIYNFGMVLLNLF 92

  Fly    69 IFVWGIHLLFV---QKPYNLSCMQVLPQDHELKSTERTLS---YMYHLNKVLDLMDTIFFVLRKK 127
            ||    ..||:   ...|:..|..|   |:.....|..::   :.|.::|.::.:||:||:||||
Mouse    93 IF----RELFMGSYNAGYSYICQSV---DYSNDVNEVRIAGALWWYFVSKGVEYLDTVFFILRKK 150

  Fly   128 QRQITFLHVFHHVFMVFTSHMLIRFYGFGGHVFLICMFNVLVHIVMYGYYYASSQSQNVQESLWW 192
            ..|::||||:||..| ||...:...:..||..|.....|..:|::||.||..::....:|:.|||
Mouse   151 NNQVSFLHVYHHCTM-FTLWWIGIKWVAGGQAFFGAQMNSFIHVIMYSYYGLTAFGPWIQKYLWW 214

  Fly   193 KKYLTLGQLVQFLLMFLH---CMYTYFQPNCSASRGVIY-VISSASAFMFLMFTKFYIKTYIRPK 253
            |:|||:.|||||.:...|   .:||    :|...:.:.: :|:.|.:|:|| |..||.:||..||
Mouse   215 KRYLTMLQLVQFHVTIGHTALSLYT----DCPFPKWMHWALIAYAISFIFL-FLNFYTRTYNEPK 274

  Fly   254 EVKSKGK 260
            :.|: ||
Mouse   275 QSKT-GK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 92/250 (37%)
Elovl4NP_683743.2 ELO 41..277 CDD:279492 92/249 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..312 5/9 (56%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03204, ECO:0000269|PubMed:24569140 308..312
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.