DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and ELOVL3

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_689523.1 Gene:ELOVL3 / 83401 HGNCID:18047 Length:270 Species:Homo sapiens


Alignment Length:284 Identity:72/284 - (25%)
Similarity:129/284 - (45%) Gaps:67/284 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PVQLPLAGSIR--------TSVIIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFN-- 66
            |....|:..:|        ||..|..:||: ::.:|:..|.:.:...|:|.|..::....:|:  
Human    17 PYNFELSKDMRPFFEEYWATSFPIALIYLV-LIAVGQNYMKERKGFNLQGPLILWSFCLAIFSIL 80

  Fly    67 SVIFVWGI---------------HLLFVQKPYNLSCMQVLPQDHELKSTERTLSYMYHLNKVLDL 116
            ..:.:|||               .:.|:.                 .||.:..|:::.|:||::|
Human    81 GAVRMWGIMGTVLLTGGLKQTVCFINFID-----------------NSTVKFWSWVFLLSKVIEL 128

  Fly   117 MDTIFFVLRKKQRQITFLHVFHH-VFMVFTSHMLIRFYGFGGHV----FLICMFNVLVHIVMYGY 176
            .||.|.:|||  |.:.|:|.:|| ..:|:||      :|:...|    :.:.| |..||.:||.|
Human   129 GDTAFIILRK--RPLIFIHWYHHSTVLVYTS------FGYKNKVPAGGWFVTM-NFGVHAIMYTY 184

  Fly   177 YYASSQSQNVQESLWWKKYLTLGQLVQFLLMFLHCMYTYF---QPNCSASRGVIYVISSASAFM- 237
            |  :.::.||:........:|..|::|..:..:..:.||.   ...|..:  :.::..|...:| 
Human   185 Y--TLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTT--MEHLFWSFILYMT 245

  Fly   238 -FLMFTKFYIKTYIRPKEVKSKGK 260
             |::|..|:.:|||||| ||:|.|
Human   246 YFILFAHFFCQTYIRPK-VKAKTK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 68/275 (25%)
ELOVL3NP_689523.1 ELO 29..266 CDD:307345 67/268 (25%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03203 266..270 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.